KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0490c
Entry
FTT_0490c         CDS       T00214                                 
Name
(RefSeq) phospholipase D
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
SSDB
Motif
Pfam: PLDc_2 PLDc PP_kinase_C FAM83
Other DBs
NCBI-GeneID: 3191396
NCBI-ProteinID: YP_169528
UniProt: Q5NHG4
Position
complement(510079..511296)
AA seq 405 aa
MRILFTILAFFGYSYGLAHGITKTIVHNYPENISKSFQISNNNYAPLQISKLIQSAKKNI
DIEVFYIDIKKDSVLDKMIIQPLAAKANQGIKVRILVDDKFYSQYSNNKASCDYLNSIKN
ITCKPTKEFQEAVMHSKMISIDGKSFYIGSHNFDWITFELNHELGVIVKNDKINAAKLEK
SFNDDWNFTNKSKKLTDNNLNTYSLHDQGNQAIVTVTPDIDKKGYPKSNLKTFISLIKSA
KSSIVIQAMIVSGIDPYMNDKNWDEFTKALSDANKRNVYVKIMFSNWMFTKSSYKDSNDW
LQKLIHQSNQNHLKIKYTSLPHTKQCVPFSEVDHAKYAIFDGTIAWVSTSNIQKSYFYAA
KNYSYIADDKDLSRQLTDVFEQLWDSKYAHTYSQPVGIISTPSCT
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgagaattttatttacaattttagctttttttggatacagttatgggttagcacatgga
attactaaaacaatagtacacaactatcctgaaaacatatcaaaatcatttcaaattagt
aacaacaattatgctcctttacaaattagtaaactaatccagagtgcaaagaaaaatatt
gatattgaagtattctacatagatataaaaaaagacagtgttctagataagatgataatt
caacctttagcagcaaaggctaatcaaggaattaaagttagaattttggtggatgacaaa
ttttatagccaatacagcaacaacaaagctagctgtgattatttaaactctattaagaat
ataacttgtaaaccgacaaaagaatttcaagaagctgtaatgcactctaaaatgataagc
attgatggtaagtctttttacattggtagtcataattttgattggataacatttgaactt
aatcatgagctaggagttattgttaaaaatgataagattaatgctgctaaacttgaaaaa
tcttttaatgatgattggaactttactaataaaagtaaaaagctaacagataataacttg
aacacatactcacttcatgaccaaggaaatcaagcgattgtgactgttacacctgatata
gataaaaaaggttaccctaaaagtaatctaaaaactttcatatcattaattaaatctgca
aaatcaagtatagtaatccaagcaatgattgtatctggaatagatccatacatgaatgat
aaaaactgggatgaatttacaaaagccttatcagacgctaataaacgaaatgtttatgta
aaaattatgttctcaaattggatgtttaccaaatcttcgtataaagatagtaatgattgg
ctacaaaaactgattcatcaatcaaatcaaaatcacttaaagatcaaatacacatcatta
ccccatacaaaacaatgtgtaccattctctgaagtagatcatgcaaaatatgctattttt
gatggtaccatagcatgggtttctacttctaatatacaaaaatcctacttctatgcggca
aaaaactattcatacattgctgacgataaagacctatcacggcaactgacagatgttttt
gagcagctttgggatagtaaatatgctcatacatattcgcaacctgttggtataatatca
actccgtcttgtacctaa

DBGET integrated database retrieval system