KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0614cHelp
Entry
FTT_0614c         CDS       T00214                                 

Definition
(RefSeq) apolipoprotein N-acyltransferase
  KO
K03820  apolipoprotein N-acyltransferase [EC:2.3.1.269]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FTT_0614c
Enzymes [BR:ftu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.269  apolipoprotein N-acyltransferase
     FTT_0614c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-GeneID: 3191149
NCBI-ProteinID: YP_169635
UniProt: Q5NH57 A0A0G2RMN0
Position
complement(633344..634834)
Genome map
AA seq 496 aa AA seqDB search
MKKLIFRIVLPLLSGAILTLAFAPFRIDILALISLILFFYQLNKATKIRSAFFTATLFGI
GFFGTSISWVYISIHLFTESIAAGLSAAVALVILLSFLHIIPFGTFSYILTRKANNFAKL
LIYPALWTLFEIVKANLLWGGFPWVSLGYSQTESPLIWYANVGGVYLVSYIIAFMACLIT
FYICNNTTLKKTASVIFIITVLYVGGVIIKYYQPNVQTNQPQKVVLIQGDFVQGFKWDPD
NFAKMQKYYQQAATEYKNSLIILSENAIPNYRQYMNSYFSKLKELADENNNAMLIGSLSI
EQTASRAKIYNSSIIIGNGQGVYNKHHLVPFGEYFPIKFFGYVDSVGLSSFNAGDKIQLI
MTAFGQPLANFICYEVAYPEQVRDQLQGAKLISIISDDSWFGDSIAREQQLQISQVRAIE
NAKYVLTTTSNGITAVIEPNGEIIKELPKDTRATLEQTIYLNDYHTIWMNIGMSLVWLLL
IFSIAIGLIIKEKYSK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagttaatatttagaatagttctgccactattaagtggtgcaatacttacttta
gcatttgcacctttccgtatagatatactagctttaatatctctaatactttttttctat
cagctaaataaagcaactaaaatccgcagtgcattttttaccgcgacattatttggaatt
ggtttttttggcactagcatatcatgggtatatataagcatacacttatttactgagtcg
attgctgctggcttgtctgcggcagttgctttagtaatcttgttaagttttttacatata
ataccttttggtacatttagctatatccttacgcgcaaagctaataattttgctaaacta
ctaatctaccctgccttatggacactttttgaaatagttaaagctaatttactctggggt
ggttttccatgggtatcgttgggctattcacaaactgaatcaccactgatatggtatgct
aatgttggtggtgtctatttagttagttatattattgcatttatggcttgtttgataact
ttctatatttgtaataatactactttgaagaaaacagctagtgtaatttttatcataact
gtattatatgtaggtggtgtcattataaaatattaccagcctaatgttcaaacaaatcaa
cctcaaaaagtagtgttaatccagggagatttcgtccaaggatttaagtgggatcctgat
aattttgctaagatgcaaaaatactatcaacaagctgccactgaatacaaaaactcatta
ataattctctctgaaaatgctatccctaattatagacaatatatgaattcatattttagt
aagcttaaagagctagctgatgaaaataataatgctatgcttattggatcactaagtatt
gaacaaacagcatctagagctaagatttacaatagttcaatcattattggaaatggtcaa
ggagtatataataagcatcacctagttccattcggtgaatatttcccaatcaaatttttt
ggctatgttgatagtgttggtttaagtagttttaatgctggtgataagattcaactaatt
atgacagcctttggtcaacctctagctaattttatctgctatgaagttgcatatcctgaa
caagttcgtgatcagctacaaggcgctaagcttatttctatcattagtgatgactcttgg
tttggtgactcgatcgcgcgtgagcaacaattgcaaatatctcaagttagagcaattgag
aatgctaaatatgttcttacgactactagtaatggtatcactgctgttattgagcctaat
ggcgaaattattaaagaactacctaaggatactcgtgcgacacttgagcaaacgatatat
ttaaatgattatcatactatttggatgaatattggtatgtcattagtttggctattgttg
atatttagtatagcgattgggctaattattaaagagaaatactccaaataa

DBGET integrated database retrieval system