KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0620Help
Entry
FTT_0620          CDS       T00214                                 

Definition
(RefSeq) HAD superfamily protein
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acid_phosphat_B
Motif
Other DBs
NCBI-GeneID: 3191144
NCBI-ProteinID: YP_169641
UniProt: Q5NH51
Position
639383..640126
Genome map
AA seq 247 aa AA seqDB search
MRQIILIFVIAMQFCFVTAYAATCNSVNIDGVKWYHDSDEKRAIYLEIYNLAVHRIKHQV
KEEHLKKGTWGVILDIDETALDNSWLEYDNYKNYSYSEEKFRQGIIEQKAKGLPGAAKLT
NLVHKLGGYVSFVSNRYGADPEIIKATEENLTKEDIYYDQILFYNEKAKNPKDKNSRFEA
VKSGKYTDDIIVTKKLPAHAVIAYFGDNIQDFPQMTQKNMRNVDNHKYTIFGEKYYIFPN
PMYGSWQ
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagacaaataatattaatctttgtgattgctatgcagttttgttttgtcactgcttat
gcagctacgtgtaatagtgtaaatatcgatggtgttaagtggtatcatgattctgatgag
aaaagagcaatttatcttgagatctataatctagctgtacatagaataaagcatcaagtt
aaagaagaacatcttaaaaaaggcacatggggtgttatcttagatattgatgagacagcc
ttagataactcatggttagagtatgataattacaaaaactatagttatagtgaagagaag
tttaggcaggggataattgagcaaaaagcaaaaggtctacctggtgctgctaaattaacc
aatcttgtccataaactaggagggtatgtaagctttgtatctaatcgctatggagcagat
cctgaaataatcaaagcaactgaggaaaaccttactaaggaggatatttattacgatcag
atcttattttacaatgagaaagctaaaaatccaaaggacaaaaattcaaggtttgaagcg
gttaaatcaggtaaatacacggatgatatcatagttactaaaaagctcccagcacatgcg
gtgatagcttattttggtgataatattcaagattttcctcaaatgacgcaaaaaaatatg
cgtaatgttgataatcacaagtatactatttttggtgaaaagtattatatttttccaaat
ccaatgtatggcagctggcaataa

DBGET integrated database retrieval system