KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0623Help
Entry
FTT_0623          CDS       T00214                                 

Gene name
tig
Definition
(RefSeq) trigger factor
  KO
K03545  trigger factor
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    FTT_0623 (tig)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trigger_N Trigger_C FKBP_C
Motif
Other DBs
NCBI-GeneID: 3190785
NCBI-ProteinID: YP_169644
UniProt: Q5NH48 A0A0M1U4F4
Position
641397..642713
Genome map
AA seq 438 aa AA seqDB search
MQVTVEKKEGIHCSLLIEVPANEIDSVVSKEINRTAKTIKMDGFRPGKVPAGMVKKKYGE
QIRMEVISDLIPQKYSKAIQDEKLAVAGIEVELKENKEGQPLKFVANLELFPEFEVTGFE
KIEVQKPVVELTDKEVKQMIENLRKQFATFSEVDKVVEKDDKVTIDFVGKKDGEAFEGGT
ANDIDVIIGSGQMIPGFEDGIIGMKKGEQKTITVTFPQDYQNKDLAEAETTFDITVKKIQ
QAELPEVNDEFVKKFGVKGGVDTFENEIKENMQRELKFILQRKVKDQVFKGLREIAEFET
PKSLIKREIDAAKQNLLKQMGGAKGFDVNQLSDNLFEANAKQKVETSLILDSIMNSQEFK
AEEAEVESLLDELVQAYEEPEKTKEQIKKNDKEIANLKALVIENKLTDWVLEQAKVTEKT
EDFFEVIKENMQAQQAGF
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttactgtagagaaaaaagaaggaattcactgttcactattaatcgaagtacca
gctaacgaaattgatagtgtagtttcaaaagaaatcaatagaactgcaaaaactatcaaa
atggatggttttagacctggtaaagtgcctgctggtatggttaagaagaagtatggtgag
caaatccgtatggaagtgatttctgatcttattcctcaaaaatactctaaagctattcaa
gatgagaagctagcagttgctggtattgaagttgaattaaaagaaaataaagaaggtcag
cctcttaagtttgttgctaatcttgagctttttcctgagtttgaggtaactggttttgaa
aaaatcgaagttcaaaagccagttgttgaattaactgataaagaagttaagcaaatgatc
gaaaatctgagaaagcagtttgcaactttctcagaagttgataaagttgtagaaaaagat
gacaaagtaacgatagatttcgttggtaagaaagatggagaagccttcgaaggtggtaca
gcaaatgatatagatgttatcatcggttctggtcaaatgattccaggctttgaagatggt
atcatcggtatgaaaaaaggtgagcaaaagactattactgtaacttttccacaagactac
caaaacaaagatcttgccgaggctgagactacttttgatattactgttaagaaaattcaa
caagctgagctaccagaggttaatgatgagtttgttaagaaatttggtgtaaaaggcggt
gtcgatacctttgaaaacgaaatcaaagaaaatatgcagcgtgagctgaaatttattcta
caaagaaaagtgaaagaccaagttttcaaaggtctaagggaaatagctgagtttgaaact
cctaaatctttgattaagagagagattgatgcagctaaacaaaacctacttaagcaaatg
ggaggcgctaaaggttttgatgttaatcaattatctgataacttatttgaagctaatgct
aaacaaaaagtagaaactagcctaatactagatagtattatgaattcgcaagagtttaag
gcagaagaggcagaagttgagagtttattagatgaactagtacaagcttatgaagagcca
gaaaaaactaaagagcaaatcaagaaaaatgataaagaaatagctaacttaaaagcatta
gtgatagaaaataagctaacagattgggtattagagcaagctaaagtaacagaaaaaact
gaagatttctttgaggttattaaagaaaatatgcaagctcaacaggctggcttctaa

DBGET integrated database retrieval system