KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0626Help
Entry
FTT_0626          CDS       T00214                                 

Gene name
lon
Definition
(RefSeq) DNA-binding, ATP-dependent protease La
  KO
K01338  ATP-dependent Lon protease [EC:3.4.21.53]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Brite
Enzymes [BR:ftu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.53  endopeptidase La
     FTT_0626 (lon)
Peptidases [BR:ftu01002]
 Serine Peptidases
  Family S16: lon protease family
   FTT_0626 (lon)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lon_C LON_substr_bdg AAA AAA_5 ChlI AAA_16 AAA_2 RuvB_N AAA_22 AAA_14 AAA_18 IstB_IS21 Torsin AAA_3 RNA_helicase AAA_33
Motif
Other DBs
NCBI-GeneID: 3190802
NCBI-ProteinID: YP_169647
UniProt: A0A0G2RNJ2 Q5NH45
Position
644646..646970
Genome map
AA seq 774 aa AA seqDB search
MSESLNVVPVIPLRDVVIYPSMTLPLNVGRKKSIEAVKQASNNYNNYILLATQKNGSSGG
DVVENIYDIATLAKVVQIMKLPDGSLKIIVEGIAKRLVAKYEDIDGCIYANLDSLHIDDN
YDPSQVDKELKAILLSVSDSLKRFVDISGRVSKESLATLINMEEPHKFIYEIATILNTEI
AKKQKILEATDIKNKALLLLSYLYEELEILELEAKIKDRVKAQVDKNQREYYLNEQVKAI
YKELGEADEESEVSALKKRIEHTKMSKEAKEKCLKELKKLKAMPPSSSESAVSRNYIETI
LSLPWGKRAKVKRDINLAEKVLEKDHYGIKKVKERILEHLAVQIKRDSNTKAPILCLVGP
PGVGKTSIGQSIARATGREYVRMALGGVRDESEIRGHRRTYIGSMPGQIIQKIIKSKTEN
PLFLLDEIDKISSDFRGDPSAALLEVLDPEQNSTFNDHYLEIDYDLSKVMFVATANSLDI
DPALRDRLEIINLSGYTEIEKQAIAKQYLIPKALENNGLTKDEINFTPKAILDIIRYYTR
EAGVRNLQQKIDGVCRKAVKNLLKDSNTGKISITQKNLEDYLGVHQYDYGVKNAKAKVGQ
VTGLAWTSVGGELLTIEALAMPGKGKVKYTGSLGDVMKESIDAAFSVVRSMSKDYKLEDD
FYEKKDIHIHVPEGATPKDGPSAGIAMTTALVSVYTNKPVRNDVAMTGEVTLRGEVLAIG
GLKEKLLAALRGGIKEVLIPKQNVKNLADVDKEILEKLEITPVSSIKEVLERVF
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaatccctaaatgtcgttcctgttattcctttaagagatgttgttatttatcca
tcgatgactctaccacttaatgttgggcgtaaaaagtcaatagaggcagttaaacaggca
tcaaataattataataactatattttattagctacacaaaaaaatggttcgagtggcggt
gatgttgtagaaaatatatatgatattgcaactcttgctaaagttgttcagataatgaaa
cttcctgatggtagtctgaaaataatagtcgagggtattgctaaaagactagtagctaag
tatgaagatattgatggttgtatctatgcaaatttagatagtttacatattgatgataac
tatgatcccagccaagttgataaagaactaaaagctattttactatcagtttctgattcg
cttaaaagatttgttgatatcagtggcagagtttcgaaagaatcattagctacattgata
aatatggaagagccacataaatttatttatgaaatagctactatacttaatacagaaata
gctaaaaaacaaaaaatccttgaggcaacggatataaaaaataaagccttgctactactt
tcatatctttatgaagagctagagatactagagctagaagctaagatcaaagatagagtc
aaagctcaagttgataagaatcagcgtgaatactatctaaatgagcaagtcaaagcgata
tataaagagcttggtgaagctgatgaagaatcagaagtatctgctttgaaaaaaaggatt
gagcatactaagatgtctaaagaggcaaaagagaaatgcttaaaagagctcaagaaactt
aaggctatgccgccttcttcatcagaatcagctgtttcgagaaactatattgaaactata
ctttctctaccatggggtaagagggcaaaagttaaaagagatattaatcttgctgagaaa
gttttagaaaaagatcattacggtatcaaaaaagttaaagaaaggatccttgagcattta
gctgttcagattaaaagagacagtaatactaaagcaccaattctgtgcttagtaggacct
ccaggagtaggtaaaacatctataggacagtcgattgctagagcaacagggcgtgagtat
gtgcgtatggctttaggtggtgtacgtgatgagtctgagattaggggacatcgtcgtaca
tacataggttctatgcctggtcaaattatccaaaagataattaaatcaaagacagagaat
ccacttttcttattagacgagattgataaaatttcttctgatttccgtggtgatccatct
gccgcgctcttagaagtacttgatccagagcaaaatagtacatttaacgatcattacctt
gagatagactatgatttatcaaaggtaatgtttgttgctacagcaaattccttagatata
gatccagcattacgtgatagattagagattatcaacttatcaggctataccgaaatagag
aagcaagctatcgcaaaacagtatttaatacctaaagcattagaaaataatggtttgact
aaggatgaaattaatttcacaccaaaagctatccttgatattatcagatattatacaaga
gaagctggtgtaagaaatcttcagcaaaaaatagatggtgtttgccgtaaagcagttaaa
aatctcttaaaggattcaaatactggcaaaatttcgattacacaaaaaaatctcgaagat
tatcttggtgtacatcagtatgattatggtgttaaaaatgctaaagcaaaagtaggtcaa
gtaacaggtttagcttggacatctgttggtggagagcttttgactatagaagctctagca
atgccaggaaaaggtaaagttaaatatactggtagtcttggtgatgtaatgaaagaatct
atagatgctgcttttagtgtggtacgctcaatgtcaaaagactataagttagaagatgat
ttctatgagaaaaaagatatacatattcatgtccctgaaggagctacaccaaaagatggt
ccaagtgctggtattgcgatgacaacggctttagtttctgtatatacaaacaaaccagtt
agaaatgatgtggcaatgacaggtgaggtgacactccgtggtgaagtgctagctataggc
ggtttaaaagaaaagcttttggcagcattaagaggtggaattaaggaggttttgatccca
aaacagaatgttaaaaatttagccgatgttgataaagaaatcctggaaaaactcgaaata
acccctgtaagtagcataaaagaggttttagagagagttttttga

DBGET integrated database retrieval system