KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0634Help
Entry
FTT_0634          CDS       T00214                                 

Gene name
hflC
Definition
(RefSeq) hypothetical protein
  KO
K04087  membrane protease subunit HflC [EC:3.4.-.-]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Module
ftu_M00742  Aminoglycoside resistance, protease FtsH
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FTT_0634 (hflC)
Enzymes [BR:ftu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     FTT_0634 (hflC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Band_7 Band_7_1 CNOT1_TTP_bind ComA V-ATPase_G_2 Ald_Xan_dh_C2 DivIVA Coleoptericin
Motif
Other DBs
NCBI-GeneID: 3192425
NCBI-ProteinID: YP_169655
UniProt: A0A0G2RMX6 Q5NH37
Position
654039..654965
Genome map
AA seq 308 aa AA seqDB search
MSKFLKIFLVLVVVLAIVVLSTKFIVKQGSEAVILRLGELVKDKDGKAVEYEPGLHIKIP
FIDTVKMYDMRNRVLEADSARVVTKEQKDVLINAYVVWKISNNNISTFYTSTSGSVDRAE
TLLKQFLESSLRAEVGNNDIQSLINNNRDKLMIALTKSVQQQAKQIGVDVIDVRVKQIDL
PETVTDSIYQRMRSSRQKVAASIRAEGKQLAEKIKAAADAKVTVTLAEAEKESKTIMAEA
DAKAAKIFTQAYSKSVPLYEFLKSMNSYKESFNGKNEVVFMLKPDSKFFQGFKLEPNSKL
AEDMKEAK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattcctaaaaatattcttagtgcttgtagtagtcttagctatagtagtatta
agcacaaaatttattgtcaaacaaggctcagaagcagttattctaagacttggtgaactt
gtaaaagataaagatggcaaagctgtagagtatgaaccaggtttacatattaaaatccca
tttatagatacagttaaaatgtacgatatgcgtaaccgagttttagaggctgattctgct
cgtgtagttactaaagagcaaaaagatgtactgattaatgcctatgtggtttggaagata
agtaataacaatatttctacattttacacaagtactagtggtagtgttgatcgagctgag
acattattaaaacaattcttggagtcttctttaagagcagaggttggtaataatgatatt
caaagtttgattaataataatcgtgataaactaatgatcgctttaactaagagtgtccaa
caacaagctaagcaaatcggtgtagatgttatcgatgtgcgagtaaaacagatagattta
cctgaaacagttacagattctatctaccaaagaatgagatcttctcgccaaaaagtagcg
gcttctatccgtgctgaaggtaagcaattagctgagaaaataaaagctgcagcagatgct
aaagtaacagttacattagcagaagcagaaaaagaatcaaaaactataatggcagaagca
gatgccaaagcagctaagatttttacccaagcttattctaaatcagtaccgttatatgag
tttctaaagagtatgaactcctataaagagagttttaacggtaagaatgaagtcgtattt
atgcttaaaccagatagtaagtttttccaaggttttaaattggaaccaaatagcaaactt
gctgaagatatgaaggaagctaaataa

DBGET integrated database retrieval system