KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0649cHelp
Entry
FTT_0649c         CDS       T00214                                 

Gene name
rnfB
Definition
(RefSeq) (Fe-S)-binding protein
  KO
K03616  electron transport complex protein RnfB
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    FTT_0649c (rnfB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4 FeS Fer4_10 Fer4_7 Fer4_9 Fer4_6 Fer4_2 Fer4_16 Fer4_17 Fer4_3 Fer4_4 Fer4_22 Fer4_8 DUF3410
Motif
Other DBs
NCBI-GeneID: 3191608
NCBI-ProteinID: YP_169667
UniProt: Q5NH25 A0A0G2RPF3
Position
complement(669624..670253)
Genome map
AA seq 209 aa AA seqDB search
MIISIEAIDKVLPQIQCQKCTYPDCYSYAKAITNGEKHNKCITGGEKTLKELAKLLNKPE
IPLDSSLGQEKPRAVAKIDESMCIGCEKCLLACPVDAIVGAKKLMHTIIEAECTGCELCV
EPCPMDCISLVDLAADKQPNNLTNHAYTTQKNHYRDRYEYHKQRVSQTKAKQRDVYKNIA
TAQEIDKKAYIAASLAKFRNKKKSSPTNE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgattatatctatagaagcaattgataaagtattaccacaaatacaatgtcaaaagtgt
acttatcctgattgttatagctatgctaaagctataacaaatggcgaaaaacataataaa
tgtattacaggtggagagaagactttaaaggagctagcaaaacttttaaataagcctgaa
atccctttagatagctcactaggacaagaaaaacctcgagctgttgcaaaaattgatgaa
tcaatgtgtattggttgtgagaaatgcttacttgcatgtcctgttgatgctatagtaggc
gcaaaaaaactcatgcacactataattgaagccgaatgtacaggctgtgaactatgtgta
gaaccatgtccaatggattgtatatctttggtagatttagctgcagataaacaaccaaat
aatctaactaatcatgcttatacaacacaaaaaaatcactatcgtgataggtacgaatat
cataagcagagagtaagtcaaacaaaggctaaacaaagagatgtttacaaaaacatcgca
actgctcaagaaattgataaaaaagcctatatagctgcttcattagctaagtttagaaat
aaaaagaaatcttcaccaaccaatgaataa

DBGET integrated database retrieval system