KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0660Help
Entry
FTT_0660          CDS       T00214                                 

Definition
(RefSeq) hypothetical protein
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ni_hydr_CYTB
Motif
Other DBs
NCBI-GeneID: 3191060
NCBI-ProteinID: YP_169677
UniProt: Q5NH15 A0A0G2RNL2
Position
679707..680294
Genome map
AA seq 195 aa AA seqDB search
MRFFKKLYFFLESFWKYLGKSQDKNFRLIHISLAILVIVQILDSDYVHTRYGLSVGAYLH
ICVGMTIAILSIIMIIAALEKRGLRYYYPYLFNDYTALKSDLSELTRLRLPNPRSGSIAA
IVQGFGLLALSIAWISGSMWFIAWNFQFDYTQNLKDLHKTLVGLIEFYICVHGIMGIVHY
FVQRYFRRFISNVDN
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcgattttttaaaaaactatattttttcttagagtcattctggaaatatttaggtaag
tcacaagataagaattttcgacttatacatatatcgcttgctattctagttattgtccaa
atacttgatagtgattatgtgcatactcgttatggcttaagtgttggagcttatttacat
atctgtgttggaatgacaatagctattttaagcattattatgataattgctgcacttgag
aaacgcggcttacgctactactatccttatctatttaatgattatacagcccttaaatca
gatttatccgaactaacaagactaaggttgccaaatccaagaagtggaagcatagctgct
attgttcaaggttttggtttactagctttgagtatagcctggatttctgggagcatgtgg
tttattgcttggaatttccaatttgattatactcaaaatttaaaagacctacacaaaact
ctagttggtttaatagagttttatatctgtgttcatggtattatgggaatagtacattat
tttgtacaaagatactttcgtagatttattagtaatgttgataattaa

DBGET integrated database retrieval system