KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0661cHelp
Entry
FTT_0661c         CDS       T00214                                 

Definition
(RefSeq) hypothetical protein
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_24 HTH_11 MarR HTH_Crp_2 Rrf2
Motif
Other DBs
NCBI-GeneID: 3191057
NCBI-ProteinID: YP_169678
UniProt: Q5NH14
Position
complement(680316..680612)
Genome map
AA seq 98 aa AA seqDB search
MPTKKQQSWTFLTNHSHVLCLINSDPNITIRDMAIKVGITERAVLNILSDLTETAYLTVT
KIGRNNHYTINKDKKLRHPIESHCNIDDFLKPLAIKKS
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgcctacaaaaaaacaacaaagttggactttcttaacaaatcattcgcatgtgttatgt
ctcattaatagtgacccaaacatcactattagagatatggctatcaaggttgggatcact
gaacgagcggtcctaaatattctaagtgacctaaccgagacagcctatctaactgtaaca
aagattggtagaaataatcattatactatcaacaaagataaaaagcttagacaccctatt
gaaagtcactgtaatattgatgatttcttgaaacctctagcaataaagaaatcttga

DBGET integrated database retrieval system