KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0663Help
Entry
FTT_0663          CDS       T00214                                 

Definition
(RefSeq) hypothetical protein
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_2
Motif
Other DBs
NCBI-GeneID: 3191056
NCBI-ProteinID: YP_169680
UniProt: A0A0G2RNB9 Q5NH12
Position
681271..682083
Genome map
AA seq 270 aa AA seqDB search
MNIVDSHIHFWDITNGYNNWVKDTNLPKLVTPENLEASAFVHIEAHSEKFDPLCEYNWLK
SKFNNSNIKVVAFVDFTLEISQFEKKIIYLSEHNNIVGIRQIMSKTYKSKYSPFEKCIPK
DLEQKLKILREHKLIFEAQMYPEQFLPLLEKINNSGVKMVVEHFGLPLFGRNNNLAEWQR
FIKECSQNTNWNLKLSGFDLNNQMSNVKKALDFVFENISFHQLCYGSNFPVSNHDDYNFW
QKFLYKYIDNDEISKHVFKNVARRIYFKEG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaacatagtagattcacatattcatttctgggatataaccaatggttataataattgg
gttaaagataccaatttgccaaaactggtaacaccagagaatttagaggcgagtgctttt
gtgcatatagaagctcacagtgagaaatttgatcctttatgtgaatataattggctaaaa
tctaaatttaacaatagtaatattaaagtagtagcttttgttgattttacattagaaatt
tctcagtttgaaaaaaagatcatatacttatctgaacataataatatcgttggcatacgc
caaattatgtcaaaaacgtataaatcaaaatatagtccatttgaaaaatgtatacctaaa
gatttagagcaaaagttaaaaattctaagagaacataaacttatttttgaagcgcaaatg
tatccagagcagtttttacctcttttagaaaaaattaataactctggagtgaaaatggtg
gtggaacattttggtctacctttatttgggcgtaataataatctagcagagtggcaaaga
ttcataaaagaatgtagtcaaaatactaattggaatcttaagctttctggttttgattta
aataatcaaatgtcaaatgtaaagaaagcactagactttgtttttgagaatatttcattt
catcaattatgttatggttcgaactttcctgtttcaaatcatgatgattataatttttgg
cagaaatttttgtataaatacattgataatgatgaaatatctaaacatgtgtttaaaaat
gtagctcggaggatttacttcaaagagggctaa

DBGET integrated database retrieval system