KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0667Help
Entry
FTT_0667          CDS       T00214                                 

Definition
(RefSeq) hypothetical protein
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-GeneID: 3191053
NCBI-ProteinID: YP_169684
UniProt: A0A0G2RME9 Q5NH08
Position
684719..685222
Genome map
AA seq 167 aa AA seqDB search
MSKLLVVINMQKGFDCSEARAVIPNLNKFYTYFDNVSFVMFENRKNSLFETQLKWIDFQN
EEDRKLIEGVEIPQNAHFTHHHNYTVYNDELKALIKKLKPAKVYLSGLFSDVCLLKTAMD
MFDDGIVPYIIKDLSGSPHGDIAHEVAFAAMKEGLGADRIISTKEIS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattattagttgttatcaacatgcaaaaaggttttgattgctctgaggctaga
gctgtaataccaaatcttaataaattttatacctattttgataatgttagttttgtgatg
tttgaaaataggaagaattcactttttgaaactcaattaaaatggattgattttcaaaat
gaagaagatagaaagcttattgaaggtgtagagataccacaaaatgcgcattttactcat
caccataactatacggtatacaatgatgagcttaaagctttaataaaaaaacttaaacca
gcaaaagtctatctttctggtctattctcagatgtttgtttattaaaaacagctatggat
atgtttgatgatgggattgtcccttatattatcaaagatctaagtgggtcaccacatggt
gatattgcacatgaagtagcatttgcagctatgaaagaaggtttaggagctgatcgtata
atatctaccaaagagataagctaa

DBGET integrated database retrieval system