KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0669Help
Entry
FTT_0669          CDS       T00214                                 

Definition
(RefSeq) sodium/hydrogen exchanger family protein
  KO
K03455  monovalent cation:H+ antiporter-2, CPA2 family
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    FTT_0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger DUF2530
Motif
Other DBs
NCBI-GeneID: 3191049
NCBI-ProteinID: YP_169686
UniProt: Q5NH06 A0A0G2RPW2
Position
685952..687127
Genome map
AA seq 391 aa AA seqDB search
MHDESLISIFVFVMLGILVVTIVLKKLKQPYVVAYLLTGILLGPYGLRLIQDQENLARLG
EIGVILLLFFAGMEVSPRKFAENWQVPTIGTMLQMLITSLIVSIIGVALGWSIAKILLFG
AVISLSSTAVVLKLLNDSGSMKTRLGQNVLGILLIQDLAVVPMLILVRLIGGEELSISQI
VTQILGGILIISIAAIMAVKKNIKISFISVLGKDEEMRVFAALVICFGMAALTESLELSS
ALGAFVGGMIVSTLEETEWVGHSLSTVKTIFMALFFISVGMLIDLKLFWNHIFLFMALLL
LIYSLNTTINALIFKALRQRTEEALIGGAMLSQIGEFSFVLISMGFASGILSLTIYHYCI
TLISLSLLFSPLWISGVNLYIKKYIKKKPQN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacgagtctttgatttccattttcgtttttgtaatgctgggcattctagtagtt
acaatagtcctaaaaaaactaaaacaaccatatgttgtagcatatttattgacaggaata
ttattaggaccgtatggattaagattgattcaagatcaagagaatcttgcaaggttaggt
gaaataggggttatcctattattattttttgcagggatggaagtctcaccacgtaaattt
gctgaaaactggcaagttccgactattggtacaatgctgcaaatgctaataacaagtcta
atagtttctataattggagtagcattaggatggagtattgcaaagatattactttttgga
gcggttattagcttaagtagtacagctgttgtgcttaaattattaaatgatagtggcagt
atgaagactcgtctagggcaaaatgttttaggaattcttttaatccaagatttagcagta
gtgcctatgcttattcttgtaagattaatcggaggcgaggagctatcaatcagtcaaata
gtaactcaaattttaggtggtattcttataatatctatagcagccattatggcggttaaa
aagaatatcaaaatatcttttatttctgtgttgggaaaggacgaggaaatgagagttttt
gcagctctagtaatttgttttgggatggcagcacttacagaatcattagaattatcatct
gctttgggtgcatttgtaggggggatgatcgtttctacacttgaagaaacagagtgggtt
ggacatagtctttcaactgttaagactatttttatggcattattttttatatctgtagga
atgttgatagatttaaaattattttggaatcatatatttttatttatggcattattgcta
ttgatatattcactgaatacaactatcaatgctttaatatttaaagcacttagacagaga
acagaagaagcattgataggtggagcgatgttatcacaaataggagagtttagctttgta
ttgatttctatgggttttgcatcaggaattttaagtttaacaatatatcattattgtatt
acgttgatatctttatcgttattgtttagtccattatggattagtggtgttaatctctat
attaaaaagtatattaagaaaaagcctcagaattaa

DBGET integrated database retrieval system