KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0673cHelp
Entry
FTT_0673c         CDS       T00214                                 

Definition
(RefSeq) hypothetical protein
  KO
K06987  uncharacterized protein
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    FTT_0673c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AstE_AspA
Motif
Other DBs
NCBI-GeneID: 3191042
NCBI-ProteinID: YP_169689
UniProt: Q5NH03 A0A0G2RPK8
Position
complement(690789..691796)
Genome map
AA seq 335 aa AA seqDB search
MKFKIFDNTFQPGEMATLAMPLPSQYSCAPMYLPTKILNGVNEGPCILIFGMVNGDEFNS
IEIINSLLEKTNPKQLNGTIVAIPVLNVFGLVHSIKHNPTLEQAFPGDENGSYMQRYAYR
ITQEIIKKANYSIQIKTGAINHEILPQVYFNGEDEESIKMARAFQAPVITAVNMNQSSIR
KIHQDLDIPFICYEAGEANKFGEEAINVGIAGIQNVMRKIALLEDQEFIQQLKPLVSEDT
EWTVSDKPGILRTEIELGTRVKEGQKIGKLIDPFGNDESIYLKSPIDGIILGINNYPMIK
EGDLVFKISSFQDDEKAEAKIEDWEEITKENFSDE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaaaatttttgataatacctttcagcctggagaaatggctacattagcaatg
ccattacctagccaatattcttgtgctccaatgtatctgccaacaaagattcttaatggt
gttaatgagggtccatgtatattaatttttggtatggttaatggtgatgaatttaacagt
atcgaaattatcaactctcttttagaaaaaaccaatcctaaacagttaaatggtacaatc
gtagctattccggtactaaatgtttttggtttagtccatagtatcaagcataaccctact
ctagaacaagctttcccaggggatgagaatggctcatatatgcaacgttatgcttataga
ataacccaagagattataaaaaaagcaaactattctatccaaattaaaacaggagctata
aatcacgagatacttccacaagtatacttcaatggtgaagatgaagagtctataaaaatg
gccagagcttttcaagcacctgtaattaccgcggtaaatatgaatcaatctagtattcga
aaaattcatcaagacctagatatcccttttatctgctatgaagctggtgaggcaaataaa
tttggtgaagaagctatcaatgttggtatagcaggtatacaaaatgttatgcgtaaaata
gctctgctcgaagaccaagaattcatccaacaactcaaaccattagtatcagaagatact
gaatggacagtctctgacaaaccagggatactcagaacagaaatagagcttggcacaagg
gtcaaagaaggtcaaaaaataggtaagctaatagatccatttgggaatgatgaaagcatt
tatctaaagtcacctattgatggaatcatacttggcataaataattacccaatgattaag
gaaggtgatctagtatttaaaatttcatctttccaagatgatgagaaagcagaggcaaaa
atagaagattgggaagaaataacaaaagaaaactttagtgatgaataa

DBGET integrated database retrieval system