KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0681cHelp
Entry
FTT_0681c         CDS       T00214                                 

Gene name
blaA
Definition
(RefSeq) beta-lactamase class A
  KO
K17836  beta-lactamase class A [EC:3.5.2.6]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu01130  Biosynthesis of antibiotics
ftu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    FTT_0681c (blaA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01501 beta-Lactam resistance
    FTT_0681c (blaA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:ftu01504]
    FTT_0681c (blaA)
Enzymes [BR:ftu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.6  beta-lactamase
     FTT_0681c (blaA)
Antimicrobial resistance genes [BR:ftu01504]
 Gene sets
  beta-Lactam resistance modules
   beta-Lactam resistance, Bla system [MD:M00627]
    FTT_0681c (blaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase2 Beta-lactamase TPM_phosphatase
Motif
Other DBs
NCBI-GeneID: 3190964
NCBI-ProteinID: YP_169697
UniProt: Q5NGZ5 A0A0G2RPT8
Position
complement(698278..699162)
Genome map
AA seq 294 aa AA seqDB search
MKKIITLIIGIIFITFSFATTKIDTQVTNDIQNIEKKHGGKIGVYTINRNDWSNFAVNAS
FYFPICSTYKFLVVGAILKQSMTDNKLLNQKIKISKNQIVEYSPITRRHINQIMTVKQLC
QASMQGDNTATNILIEKLGGLKNLNKFILSLADHATKVANLEPKVNHVSLTTNENKTTPK
IMARDINKLAFSDDILDKKHRLMFKQWLIASNTSNNRIAAEVPDEWEVGDKTGTCQYGTT
NDVAIIWPDDNRAVIMAIFYTQSQKNAKPNSKIVREVTKILLNRLQLNNTTKNA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataattacgctgataattggtataatatttataacttttagttttgctact
acaaaaatagatacccaagttaccaatgatattcaaaatatagaaaaaaaacatggtggt
aaaattggtgtatatactataaatcgaaatgactggagtaattttgcagtcaatgctagc
ttctactttccaatatgtagtacttataaatttcttgtagttggtgcaatacttaaacaa
agtatgactgataataaactacttaatcaaaaaatcaaaatctcaaaaaatcaaattgtt
gagtattcccctattacaagaaggcatattaatcaaataatgactgtgaaacaactttgc
caagcatctatgcaaggggataatactgcgacaaatatcctaattgaaaaactaggtggt
ttgaaaaatctcaataagtttatcttatcgcttgcagatcatgcgacaaaagtcgctaat
ttagagcctaaagtcaatcatgtcagcctaacgacaaacgaaaataagaccactcccaag
attatggcaagagatattaataaacttgcttttagcgatgatatacttgataaaaaacat
cgcttaatgtttaaacaatggctaatagcgagtaatactagcaacaatcgtatagctgct
gaggtgcctgatgagtgggaagttggtgataaaactggaacttgtcaatatggtacaaca
aatgatgttgctattatttggcctgatgataatagagctgttattatggcaattttttat
acccaatcgcaaaaaaatgctaaaccaaacagtaaaattgttagagaggtaactaaaata
ctgctaaacagactacaattaaacaatactacgaaaaatgcctaa

DBGET integrated database retrieval system