KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0682cHelp
Entry
FTT_0682c         CDS       T00214                                 

Definition
(RefSeq) hypothetical protein
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_2 Chordopox_G3 Thioredoxin_4
Motif
Other DBs
NCBI-GeneID: 3191037
NCBI-ProteinID: YP_169698
UniProt: Q5NGZ4 A0A0G2RNI0
Position
complement(699171..700016)
Genome map
AA seq 281 aa AA seqDB search
MQKKSFSILVLFVVILLVVLYIFSTTNLNKISPDNKQGLYLVEHAFPQYKVIKTFDTGIH
LQAYILEDKKDPTKHSVTFTSEDGAVIVNGELLAWDSNQNKLTSLNNIYANYFTSSPQAN
NLYLNIKKYATYIQQGSDDAPHKFYAIINPSCSYCNRLFDATQPAINSGELAVRWIPLGA
LRNSPEIVRSIFNSKDPLEALIKYHKTKTYDQKLTQQNEKAENNLRLSSDIEGFPTIVYK
TPQGALKISGGNKLPLTDATIAAKDNINKINEFLLLTSNSF
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaaaaagcttctctattctagttttatttgttgttatactattagttgtactg
tatatttttagtactactaatcttaataaaatctcaccagataacaaacaaggcttatac
cttgttgagcatgcctttccacaatataaggttataaagacttttgacacaggtatccat
ctacaagcatatattctagaagacaaaaaagatccaacaaaacatagtgttacttttact
agtgaagatggtgctgtaattgttaatggtgaacttttagcatgggatagtaatcaaaac
aagctaactagtttaaataatatttatgcaaactatttcacttcatcacctcaagcgaac
aatctttatctaaacatcaaaaagtatgctacatacatccagcaaggcagtgatgatgcg
ccacataagttctatgctattataaaccctagttgcagctattgtaatcgtctatttgat
gcgactcaaccagcaattaactcaggagaacttgcagtacgctggattcctttaggtgca
ctgcgtaatagcccagagattgttagaagtatttttaactcaaaagatcctcttgaagca
ttgattaaatatcataagacaaaaacatatgatcagaaattaactcaacaaaatgaaaaa
gccgaaaataatttaaggttatcgagtgatattgaaggtttccctacaattgtttataaa
acacctcaaggagctttaaaaatctcaggtggtaacaagcttccacttacagatgctact
atagcagcaaaagataatatcaataaaattaatgaatttttgctattaacctcaaatagt
ttctaa

DBGET integrated database retrieval system