KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0689Help
Entry
FTT_0689          CDS       T00214                                 

Definition
(RefSeq) hypothetical protein
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 3191031
NCBI-ProteinID: YP_169705
UniProt: Q5NGY7 A0A0G2RMN7
Position
707279..708028
Genome map
AA seq 249 aa AA seqDB search
MSNLNFKGTISLAATIYKRAFKITFALAFMLSFISEFCFVYLMNHGMDKFIQSNGEADVS
QLPSGNILAAMFLIIMVATIFVYAMIIILQGIMIKHELKVSDALKIALQIFSKRVFAFLG
AFLLSMIAMTLFTMFLQYIGIFLAILLFLTVMPAVLLAQKGVFESLSANFYAVKNNFFYM
FRISITILAFMIIKPLLTFGLIYLLKDLGVEIGSLEMSIQNIVVTVVDAFILPFIFAISV
AAFFSTSSK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatttaaattttaaaggaactatttcgctagcagcaactatatacaagagagct
tttaagataacttttgcattagcttttatgctttcatttatctctgagttttgttttgtt
tatctgatgaaccatggtatggataagtttatccaaagtaatggtgaagctgatgtttct
cagttaccatcgggaaatattttagcagctatgtttttgataattatggttgcgacaata
tttgtttatgcgatgataattattttacaaggaattatgatcaagcatgagctgaaagta
tctgatgcactaaaaatagctctacagatattttcgaaaagagtgtttgcatttcttgga
gcatttttactttcaatgattgcgatgacattatttacaatgtttttacagtatataggt
atttttttagcaatattattatttttgactgttatgcccgcagtattattagcgcaaaaa
ggtgtttttgagtcattatcagctaatttctatgcagtaaaaaataattttttctatatg
tttagaatttcaataactattttagcgtttatgattatcaagccattattaacgtttggt
ttaatatatctgttaaaggatttaggtgtggaaattggttctttagaaatgtctattcaa
aacattgttgtgacagtagttgatgcttttattttaccttttatttttgctattagtgtt
gcagcatttttttcaacaagttctaaataa

DBGET integrated database retrieval system