KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0690cHelp
Entry
FTT_0690c         CDS       T00214                                 

Gene name
lplA
Definition
(RefSeq) lipoate-protein ligase A
  KO
K03800  lipoate---protein ligase [EC:6.3.1.20]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu00785  Lipoic acid metabolism
ftu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    FTT_0690c (lplA)
Enzymes [BR:ftu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.20  lipoate---protein ligase
     FTT_0690c (lplA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPL_LplA_LipB
Motif
Other DBs
NCBI-GeneID: 3192472
NCBI-ProteinID: YP_169706
UniProt: Q5NGY6 A0A0G2RML4
Position
complement(708031..708933)
Genome map
AA seq 300 aa AA seqDB search
MHIYISQSNDIYFNLAFENWLFLEKLHQQKILFLWQNSPCVVIGRAQNPWLECNLEAMDN
DKIPMIRRQSGGGTVYHDYGNLNYTIISTKKDHDIKANLELVCNAIKKLGIDVYPNRRND
IVLDHHNYTYKISGSAFREKKDRAFHHGTLLINANTKKLYDYLHQPIDKSLDTKGVKSHR
SKVINLSEIKHDIQTQDITRSFIKSFRSIDLSLINEETPLENKELIEKEIEILKDWQWRF
GKTLPFTKTYTKASEQIKIKIESGIVTEVRNVYKNTNLADKNIRFENRYDFDFFKKILTE
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcatatatacatatctcaaagtaacgatatctattttaatttagcttttgaaaattgg
ttattcttggagaagctgcatcaacaaaaaattttattcttgtggcagaattctccttgc
gttgttattggtagagcccaaaatccttggcttgagtgcaatcttgaagctatggataat
gataaaataccaatgattcgtcgtcaaagtggtggcggtacggtttatcatgattatggt
aatcttaattacactattatcagcactaaaaaagatcatgatatcaaagcaaatttagaa
ctagtttgtaatgctattaaaaaactaggcattgatgtatatcccaaccgaagaaatgat
attgttcttgatcatcacaactatacatataaaatatcaggtagtgcctttagagaaaaa
aaagatcgagcttttcatcatggtactctattgattaatgcaaatacaaaaaagctttat
gattatcttcatcagccaatagataaatctctcgatactaaaggagttaaatctcaccgt
tcaaaagtaatcaatctatctgaaataaagcatgatatacaaactcaggatataactaga
tctttcattaaaagctttagaagtattgacctaagtttaatcaatgaagaaactccatta
gaaaataaagagcttatagaaaaagaaattgaaatcttaaaggattggcaatggcgtttt
ggtaaaactttgccttttacaaaaacttatacaaaagcaagtgaacaaattaaaatcaaa
attgaatctggaattgttacagaagttaggaatgtttataaaaatacaaatcttgctgat
aagaatattcgctttgaaaatagatatgattttgatttctttaagaaaattcttacagaa
taa

DBGET integrated database retrieval system