KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0691Help
Entry
FTT_0691          CDS       T00214                                 

Gene name
tyrS
Definition
(RefSeq) tyrosyl-tRNA synthetase
  KO
K01866  tyrosyl-tRNA synthetase [EC:6.1.1.1]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu00970  Aminoacyl-tRNA biosynthesis
Module
ftu_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FTT_0691 (tyrS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ftu01007]
    FTT_0691 (tyrS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ftu03016]
    FTT_0691 (tyrS)
   03029 Mitochondrial biogenesis [BR:ftu03029]
    FTT_0691 (tyrS)
Enzymes [BR:ftu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.1  tyrosine---tRNA ligase
     FTT_0691 (tyrS)
Amino acid related enzymes [BR:ftu01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   FTT_0691 (tyrS)
Transfer RNA biogenesis [BR:ftu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    FTT_0691 (tyrS)
 Prokaryotic Type
    FTT_0691 (tyrS)
Mitochondrial biogenesis [BR:ftu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    FTT_0691 (tyrS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1b S4 TyrRSs_C S4_2 Glucosaminidase
Motif
Other DBs
NCBI-GeneID: 3191006
NCBI-ProteinID: YP_169707
UniProt: Q5NGY5 A0A0H3TPT1
Position
709046..710236
Genome map
AA seq 396 aa AA seqDB search
MSSIKETLEIIKRGADEVLIEEELIKKLQKHKPLIIKFGCDPTAPDIHLGHTVVINKLKQ
LQDLGHKIHFLIGDFTAQIGDPTGKNATRPPLTAEEVAANAETYTKQVFKILDKDKTIIR
RNGDWFNKMSASEMIKLASKSTVARMLERDDFSKRYKGGQSISIHEFLYPLVQGYDSVAM
NADIELGGTDQKFNLLMGRELQKQQGQEPQVIITMPLLEGLDGVKKMSKSSQNYIGIEEP
ANEIFGKIMSISDEFMWRYYELLSFKSLENIAKLKQDVAAGANPRDIKIELAKELIERFH
SKEDAESAHQDFIQRFQKNQIPDDINVVELNQELPIANLLKEAGLVASTSEANRMIQQGA
VKIDGEKLSDAKIIFAKGTNNVFQVGKRKFAKIIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcataaaagagactttagaaattatcaaaagaggggcggatgaggtcctaatc
gaagaagaattaatcaaaaaattacaaaaacataagccattaataattaaatttggttgc
gacccaactgctccagatattcatttgggacatactgtagttatcaataagctaaagcaa
ttacaagatttgggacataaaattcactttttgatcggggattttacagctcagataggt
gatcctacaggtaaaaatgcaacaagaccgccattaactgccgaagaagttgcggcaaat
gctgaaacttatactaagcaagtatttaagattcttgataaagacaaaactattattcgt
cgtaatggtgattggtttaacaaaatgtctgctagtgagatgatcaaactagcttctaaa
tcaacggttgcaagaatgcttgaaagagatgatttctcaaaaagatataaaggcggacag
tcgatctcaatacatgagtttttatatccattagtacaaggatatgattctgtagctatg
aatgctgatattgagcttggaggtacagatcaaaaatttaacctactaatgggtagagag
ctgcaaaagcagcagggtcaagaaccacaagttattatcacaatgccacttttagaaggt
ttagatggcgtcaaaaaaatgtctaaatcaagccaaaactatatcggtatcgaagaacca
gcaaatgaaatctttggtaagataatgtcaatttcagatgaatttatgtggcgctattat
gaattactaagtttcaaatctttagaaaatatcgctaaattaaagcaagatgttgcagct
ggagctaatccgcgcgatattaagatagagctggcaaaagagttaattgaaaggtttcac
tctaaagaagatgctgagagtgcgcaccaggattttattcaaagattccaaaaaaatcag
atacctgatgatataaatgttgtagaattaaaccaagagctaccgatagcaaacttatta
aaagaagcaggcttagttgcaagtacttctgaagctaatcgtatgattcagcaaggtgct
gttaaaatcgatggtgaaaagcttagtgatgctaagattatttttgctaaaggaacaaat
aatgttttccaagtaggaaaacgtaaatttgcaaaaattattataaaatga

DBGET integrated database retrieval system