KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0698Help
Entry
FTT_0698          CDS       T00214                                 

Gene name
rpsO
Definition
(RefSeq) 30S ribosomal protein S15
  KO
K02956  small subunit ribosomal protein S15
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu03010  Ribosome
Module
ftu_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FTT_0698 (rpsO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ftu03011]
    FTT_0698 (rpsO)
Ribosome [BR:ftu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    FTT_0698 (rpsO)
  Bacteria
    FTT_0698 (rpsO)
  Archaea
    FTT_0698 (rpsO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S15
Motif
Other DBs
NCBI-GeneID: 3191158
NCBI-ProteinID: YP_169714
UniProt: Q5NGX8 A0A0M1U495
Position
717672..717938
Genome map
AA seq 88 aa AA seqDB search
MLTAQDKQKIIKENQLAESDTGSPEVQVALLTARINDLQGHFEAHKKDNHSRRGLLRLVS
QRRKLLDYLHDKDVERYRSLIKKLNIRR
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgttaacagctcaagataagcaaaaaataattaaagaaaatcaattagcagaaagtgat
actggatcgccagaagtgcaagtagctcttttaactgctagaatcaatgatttacaaggt
cattttgaggctcataaaaaagataatcactcaagaagaggtcttttaagattagtaagt
caacgtcgtaagttattagattatctacatgataaagatgttgaaagataccgtagtcta
atcaagaaattaaatatacgtagataa

DBGET integrated database retrieval system