KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0700Help
Entry
FTT_0700          CDS       T00214                                 

Definition
(RefSeq) iron-sulfur cluster insertion protein ErpA
  KO
K15724  iron-sulfur cluster insertion protein
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    FTT_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-S_biosyn
Motif
Other DBs
NCBI-GeneID: 3191027
NCBI-ProteinID: YP_169716
UniProt: Q5NGX6 A0A0H3TMY2
Position
720082..720432
Genome map
AA seq 116 aa AA seqDB search
MSEVVQSVDPINFTEAASLKVKELIEEEGDNSLSLRVYITGGGCSGFQYAFAFDNEVKED
DMVITKNGVRLLVDSMSFQYLVGADVDYKDDVEGAYFVIRNPNAKTTCGCGSSFSV
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtagttcaaagcgttgatccgataaactttacagaagccgcttctttaaag
gttaaagaactaattgaagaggagggtgataattctcttagccttagagtatacatcacc
ggtgggggctgttctgggtttcaatatgcttttgcttttgataatgaagtaaaagaagat
gatatggttattactaaaaatggtgttcgccttttggtagattctatgagttttcagtac
ttggttggtgctgatgttgactacaaagatgatgtcgaaggtgcatactttgtaattaga
aatccaaatgcgaaaactacttgtggctgtggttcatctttttctgtataa

DBGET integrated database retrieval system