KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0702Help
Entry
FTT_0702          CDS       T00214                                 

Gene name
udk
Definition
(RefSeq) uridine kinase
  KO
K00876  uridine kinase [EC:2.7.1.48]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu00240  Pyrimidine metabolism
ftu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    FTT_0702 (udk)
Enzymes [BR:ftu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.48  uridine kinase
     FTT_0702 (udk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRK AAA_18 AAA_17 Pox_A32 MobB AAA_33 cobW T2SSE NACHT Thymidylate_kin KAP_NTPase NB-ARC Zeta_toxin ABC_tran CoaE RNA_helicase PhoH DUF463 Mre11_DNA_bind T3SS_needle_reg APS_kinase DUF2075 ATP-synt_ab AAA_19
Motif
Other DBs
NCBI-GeneID: 3192488
NCBI-ProteinID: YP_169718
UniProt: A0A0G2RQ72 Q5NGX4
Position
721301..721966
Genome map
AA seq 221 aa AA seqDB search
MAGKGDVFIIGIVGGSGSGKTLFSNAIIKKLKSKHLNKIAVISEDRYYKNWGEMVGFEEA
CKINYDHPDAFDHKLLRKDLNNLVQGNDIYIPHYDYTTHSRVEEKAEKITGGVSVIILEG
IMLFNDRKLLKMMDFKVYMDTPADLCFIRRLMRDQNERGRSVESVINQYLETVRPMHIKF
IEPSKRKADIIIPDGAQNKTVIDIIYNKVRQLLKKNGVKNG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggctggtaaaggcgatgtttttataataggtatagttggtggttctggttctggtaaa
acattattttcaaatgctatcatcaaaaaattaaaatcaaaacatttaaacaaaattgct
gtaatttctgaggatagatattataaaaattggggtgagatggttggctttgaagaggct
tgtaaaatcaactatgatcatcctgatgcttttgatcataaattgttaagaaaagattta
aacaatttagttcaaggtaatgatatctatattcctcattatgattacactactcattca
agggttgaagaaaaagcagaaaaaattactggcggtgtaagtgtaattatattagaagga
attatgctatttaatgatcgtaagttattaaagatgatggattttaaggtatatatggat
acgcctgctgacttatgttttatcagacgcttgatgcgtgatcaaaatgaaagaggcaga
agcgttgagagtgtcataaatcaatatctagaaacagtgcgaccaatgcatattaagttt
attgagccatcaaaaagaaaagcagatattataattccagatggtgcgcaaaataaaact
gtaattgatataatatataataaagtaagacaattattgaaaaaaaatggagtaaaaaat
ggctag

DBGET integrated database retrieval system