KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0703Help
Entry
FTT_0703          CDS       T00214                                 

Gene name
rpoZ
Definition
(RefSeq) DNA-directed RNA polymerase subunit omega
  KO
K03060  DNA-directed RNA polymerase subunit omega [EC:2.7.7.6]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu00230  Purine metabolism
ftu00240  Pyrimidine metabolism
ftu01100  Metabolic pathways
ftu03020  RNA polymerase
Module
ftu_M00183  RNA polymerase, bacteria
Brite
KEGG Orthology (KO) [BR:ftu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FTT_0703 (rpoZ)
   00240 Pyrimidine metabolism
    FTT_0703 (rpoZ)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    FTT_0703 (rpoZ)
Enzymes [BR:ftu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     FTT_0703 (rpoZ)
Transcription machinery [BR:ftu03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Core subunits
     FTT_0703 (rpoZ)
DNA repair and recombination proteins [BR:ftu03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase complex (RNAP)
      FTT_0703 (rpoZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_pol_Rpb6
Motif
Other DBs
NCBI-GeneID: 3191977
NCBI-ProteinID: YP_169719
UniProt: Q5NGX3 A0A0M1U514
Position
721959..722177
Genome map
AA seq 72 aa AA seqDB search
MARVTVEDCLDKVETRFDLVVLASMRANKILKNGYSESMENEKKEKATVVALREIAESEI
TPEQILRNEIEG
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atggctagagtaacagtagaagattgcttagataaagtagaaacaagatttgatttagta
gttttagcttctatgcgagcaaataagatactaaaaaatggctactctgaatctatggaa
aatgagaaaaaagaaaaagcaacggttgtggctttaagagaaattgctgagtcagaaatt
accccagaacaaattttaagaaatgagatagaaggataa

DBGET integrated database retrieval system