KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0707Help
Entry
FTT_0707          CDS       T00214                                 

Definition
(RefSeq) nicotinamide mononucleotide transport (NMT) family protein
  KO
K03811  nicotinamide mononucleotide transporter
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Brite
Transporters [BR:ftu02000]
 Other Transporters
  Others
   FTT_0707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NMN_transporter
Motif
Other DBs
NCBI-GeneID: 3191025
NCBI-ProteinID: YP_169722
UniProt: Q5NGX0
Position
725383..726177
Genome map
AA seq 264 aa AA seqDB search
MLVNLFRIYCMNIQVINDFFSQLANYFRGFKNIKLSNIFNDWNIFEILWLVISVTSLGII
SILTTNDYLVITTIATVTGMLNILLLAKGKILNYFFAFINNLTYAYVCYNQGIYGQFLLF
TFFFFPMQFYGLYTWTKPQNTSENNDIITKSLSVKQRTYLTIAIIIATYIYGTFILKGYF
NQQVGLIADSLTGVVSVVAIILMVKAYIEQWVLWIIINTLSTIIWLQQYFSGTGEGIAFL
AMWLIYLLNALYGYINWIKLKKID
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ttgctggttaatctatttaggatatattgtatgaatattcaagttattaatgattttttt
tcgcaactagcaaattattttcgaggatttaaaaatataaagctttcgaatatttttaat
gattggaatatttttgaaatattgtggctagtgatttctgtaactagtctaggaattata
agtattttaacaacaaatgattatttagttattacaactatagctaccgttactggtatg
ctaaatattttattattagctaaaggtaaaattcttaattatttttttgcatttattaat
aaccttacttatgcatatgtttgctataatcaaggtatttatggccaatttttactcttt
acctttttcttttttcctatgcagttttatggtttatacacttggactaaaccacaaaat
actagcgagaataatgatatcattacaaagagtttatcagtaaaacaaagaacctatctt
accatagctataattattgcgacatatatttatgggacttttattttaaagggttatttt
aaccaacaagttggtttgattgccgattcattgactggtgtagtatccgttgtagctatt
atcctgatggttaaagcctatattgaacaatgggttttatggattataataaatacactt
tcaacgattatttggttgcaacaatatttttctggcacaggtgaaggtatagcgttttta
gctatgtggcttatttatctgttaaatgctttatatggctatataaactggataaaatta
aaaaagattgattaa

DBGET integrated database retrieval system