KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0710Help
Entry
FTT_0710          CDS       T00214                                 

Gene name
ftsB
Definition
(RefSeq) cell division protein
  KO
K05589  cell division protein FtsB
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ftu03036]
    FTT_0710 (ftsB)
Chromosome and associated proteins [BR:ftu03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    FTT_0710 (ftsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DivIC RcbX Pox_LP_H2
Motif
Other DBs
NCBI-GeneID: 3191079
NCBI-ProteinID: YP_169725
UniProt: Q5NGW7 A0A0H3TQF3
Position
729005..729295
Genome map
AA seq 96 aa AA seqDB search
MDIKSNSFFYIFISVVLLLIAILQYDLWFSNTGFIKYQALKKSVISQQKEVKHKSQTNVQ
LYSEVVSLRQNSEVLESLARENMGLIKQGEVFYSVK
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggatatcaaatctaactcttttttttatattttcatttctgtagttttattactaata
gcaatattgcaatatgatctgtggtttagtaatacaggctttattaagtatcaagcacta
aaaaaatctgtaattagccagcaaaaagaagtaaagcataaatctcagactaatgtacaa
ttatattctgaagtggtttcactacgtcaaaatagtgaggtgcttgaaagcttagctcgt
gagaatatgggcctaatcaagcaaggagaggttttttatagtgtcaaataa

DBGET integrated database retrieval system