KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0711Help
Entry
FTT_0711          CDS       T00214                                 

Gene name
ispD
Definition
(RefSeq) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  KO
K00991  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC:2.7.7.60]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu00900  Terpenoid backbone biosynthesis
ftu01100  Metabolic pathways
ftu01110  Biosynthesis of secondary metabolites
ftu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FTT_0711 (ispD)
Enzymes [BR:ftu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.60  2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
     FTT_0711 (ispD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IspD NTP_transf_3 DNA_pol3_delta2 CTP_transf_3
Motif
Other DBs
NCBI-GeneID: 3190877
NCBI-ProteinID: YP_169726
UniProt: A0A0G2RP99 Q5NGW6
Structure
PDB: 

Position
729285..729974
Genome map
AA seq 229 aa AA seqDB search
MSNKYVIIPAAGIGTRMQLDIPKQYYKLNNGKTILDNTLVKFIDNPLFDKIFVAIAASDN
FWNNSLYYNHDKIVVCNGGETRFNSVYNALKVIDERKNDDWVFVHDAARPCVSIDSIIDL
YEQTKSSHSQAGILAVRAYETVKQVTKNIVVKTLARNNIWLAQTPQLSRLGQLEKAFDFC
YSNNLVAKVTDEASALEMFGINPIVVECSKKNIKITTKDDLEYANWQLG
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaataaatacgtaattattccagctgctggaataggtactaggatgcagttagat
attcctaaacaatactataaacttaataatggtaagactatccttgataataccttagta
aagtttattgataatcctttgtttgataagatctttgttgcaattgctgctagtgataat
ttttggaataattcgttatattataatcatgacaaaatagtagtttgtaatggtggagag
actagatttaatagtgtttataatgcgctaaaggtcattgatgaacgcaaaaatgatgat
tgggtttttgtccatgatgctgccagaccttgtgttagtattgatagtattatagatttg
tatgagcagactaaatcatcacactcacaagcaggtatacttgctgtgagagcgtatgag
acagttaagcaagttacaaagaatatagttgtcaaaacactggctcgtaataatatttgg
cttgcacaaacacctcaattatctaggcttggacagttagagaaagcttttgatttttgc
tattcaaataatcttgttgctaaagtaactgatgaagcatcagctttagaaatgtttggt
ataaatccgattgttgttgaatgttcaaagaaaaatattaagattacaactaaagatgat
ttagaatatgctaattggcagttaggttaa

DBGET integrated database retrieval system