KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0712cHelp
Entry
FTT_0712c         CDS       T00214                                 

Gene name
sdaC1
Definition
(RefSeq) serine transporter
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_Tyr_perm
Motif
Other DBs
NCBI-GeneID: 3192377
NCBI-ProteinID: YP_169727
UniProt: A0A0G2RNH4 Q5NGW5
Position
complement(729979..731241)
Genome map
AA seq 420 aa AA seqDB search
MKKPDYSNTTKVDIQWVFTLFGTAIGAGLLYLPVQAGDSGLWALVTVLIFALPLTYYSHK
NMSNIVLCTDNGGITDVFTHNLGRFFGLTCVVLYFFAIFLNMPMYSIGLNSELSNFLLNY
NIVKTNLSTHIWFSFSILAVLLIIVSLGINIILKFMQLIVILLIILVVTLSIYIIPYWNF
EFITDSHFDTVGYITGVLMVLPILILSMNHSPVISNLVIFYRDYVKVERSQEKYKVYKIL
KINALILFIFVLLFVTSCLLSTTIPDLNRANANNLTIVTLIQEQHHSTLLNILAPMIVFT
AIISSFIGCYIGSKEALKYLFKYFFKNIYKIEFSDSLINKICVGLIFIVLWICTICNFKI
LNIIGILVAPTVAFLLYVLPVIIIYKNIQCKDYRRVILDSILFIMGLIIIFGHVIGLLLK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccagattactcaaatactacaaaagtcgatatccagtgggtatttacgtta
tttggtactgcaataggtgcagggttactttatctacctgttcaagcaggggatagcggc
ctttgggctttagtaacagtacttatttttgctttacctttaacgtattactcacataaa
aatatgtcaaatattgtactttgcacagataatggtggtattacagatgtatttacccac
aatcttggtagattttttggtttaacctgcgtagtgctatatttctttgcaatattccta
aatatgccaatgtactctattggtctaaatagcgaactaagtaattttcttttaaactac
aatattgtaaaaaccaatttatcaacacatatatggtttagttttagtattttagccgtt
ttattaataatagtttctttaggtatcaatataattctaaagtttatgcagcttatagtt
atattattgattatattagtagtgacactgtccatatatataataccttattggaacttt
gagtttataactgatagtcattttgatactgttggttatattacaggtgtattaatggta
ttaccaatcttgatattatcgatgaatcactcacctgttatttctaatctagtaattttt
tatcgtgattatgtaaaagttgagcgatcacaagaaaaatataaagtttataaaatactt
aaaattaatgctctaattctttttatctttgtactgctttttgtaacatcttgcctactt
agcactactataccagaccttaatagggctaatgcaaataatctaacaatagtaactcta
atacaagagcagcatcatagtactttattgaatattttagcaccaatgatagttttcact
gctattattagttcatttataggctgttacataggttcaaaagaagctttgaaatatcta
tttaaatatttctttaaaaatatttataaaatagaattttctgattcattaataaataaa
atctgtgttgggctaatatttatagttctctggatatgcacaatatgtaattttaaaatc
cttaatattataggcatattagttgcgcctactgtggcttttctactatatgttttacct
gtaataataatttacaaaaatatccaatgtaaagattatagacgcgtaatattagactct
attttatttataatgggattaataattatatttggccatgtaattggtttacttctaaaa
taa

DBGET integrated database retrieval system