KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0715Help
Entry
FTT_0715          CDS       T00214                                 

Definition
(RefSeq) chitinase
  KO
K01183  chitinase [EC:3.2.1.14]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu00520  Amino sugar and nucleotide sugar metabolism
ftu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FTT_0715
Enzymes [BR:ftu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.14  chitinase
     FTT_0715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_18 fn3 CBM_5_12 Pur_ac_phosph_N Interfer-bind
Motif
Other DBs
NCBI-GeneID: 3191020
NCBI-ProteinID: YP_169730
UniProt: A0A0G2RND5 Q5NGW2
Position
734050..736332
Genome map
AA seq 760 aa AA seqDB search
MNKTKLVSVVCALMGLGSYSLLEAAPVNDVKTYDFKAPFKDYNNKIVLSINNVPSAKVVE
FTSNFKPKTGWGSCFGTRADLVNFETTQLSNGEYLTKLSLKDSEGSLDLTQTCDIMGTDS
GNALVLPGVVVPIVSSVKVDGKDLEIERPCADNVCEDPTPGYTNAAYYAQWAVWGRKYNP
YDFKYDKLNTIIYAFIGFDKNTGNIKTLDASADSWGLSAAARAAKKYPYLKSFLSFGGWT
NNGVTTAPMFEQLASNQQSMENFAKQSVELMRKLGFNGIDIDWEWWSDYGDDVAPAKKML
AFFKVLRAELDKASKADGKKYYLAIAVNGARSRIEAMENPNNPNSVADFWKQIGELMDEI
NIMNYDYQGGWGTGAPAWFQASAAFPNINFSPEVANSIGKTGGWSVQGSVDAYIKAGVPA
KKLIVGLPLYARSMTVASDTDGGLLQTITAPGFGDYEAGVFDYKCLINPVNDPVNGCGTA
KPISGLSDLVYYDISSNVDIFNKYGKVAMQPWAYSPSTKTFVTFDDVWSVSEKTKYAKSK
NLGGTMFWQADGDSTDTNKSLINAVAKVYASDTINVSVSDVTENSASISWNKPELDGSIK
YRVLLNGKTIAENITSQSYVLTNLDKGTRYTIEVIASTSNASREDSITFETIGADDQNND
QNNDQNNNAGSTGNWNAEAVYNKGDKVIVNGVTYEAQWWTQGNNPADGGAWKKPFVSGEA
WSQGQAYTGGQVVTYQGAKYKAKWWTQGDIPSNSNVWEKQ
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacaaaattagtctcagtagtatgtgcattgatgggtttgggatcatattca
ctgctagaagcagcgcctgtaaatgatgttaaaacatatgacttcaaagcaccatttaag
gattataataacaaaatagtcctaagtatcaacaatgtaccatcagcaaaagtagttgaa
tttacaagtaactttaaaccaaaaactggttggggtagttgttttggtactcgagcagat
cttgttaattttgaaacaacacaactaagtaatggagaatacctaacaaaattatcgctt
aaagatagtgaaggttcgttagatctaactcaaacatgtgacattatgggtactgactct
ggtaatgcactagtattgccaggtgtggttgttcctatcgttagtagtgtaaaagttgat
ggcaaagatttagaaattgaaagaccgtgtgcagataatgtttgtgaggatccaactcca
ggatacactaatgctgcatactatgctcaatgggcagtttggggacgtaaatataatcca
tatgacttcaaatatgataagttaaatactataatctatgcatttataggttttgataaa
aatactggcaatatcaaaacactagatgcttcagctgactcatggggattatcagcagca
gcaagagcagctaaaaaatatccttatctaaaatcattcttatcatttggtggttggact
aataatggtgtgacaacagcaccaatgtttgaacaattagcttcaaatcagcaaagtatg
gaaaactttgctaagcagtcagttgagctgatgcgtaagcttggctttaatggtattgat
attgactgggagtggtggtcagattatggtgatgatgttgctccagctaaaaagatgttg
gctttctttaaggttttacgtgctgagttagacaaagctagtaaagcagatggtaaaaaa
tattaccttgcaatagctgtaaatggtgcgagaagtcgtattgaagcaatggaaaaccct
aataatccaaatagtgttgcagatttctggaagcaaattggcgagcttatggatgaaatt
aatattatgaactacgactatcaaggtggttggggtactggtgcaccagcttggttccaa
gcatcagcagcattcccgaatatcaacttctctccagaggttgctaattcaattggtaaa
acaggtggttggtcagtacaaggctcggtagatgcttatatcaaagcgggtgttcctgct
aagaaactaattgttggtttaccactatacgctagatcaatgactgtggctagtgatact
gatggaggtttgttacagactattacagcacctggatttggtgactatgaagcaggggta
tttgattataaatgtttgattaatcctgtaaatgatcctgtaaatggttgcggtactgca
aaacctatcagcggtttatcagatctagtttattatgatatcagttcaaatgttgatatc
tttaacaagtacggtaaagtagcaatgcaaccatgggcatatagtccatcaacgaagact
tttgtaacttttgatgatgtatggtctgtaagtgaaaaaactaagtatgctaagagtaaa
aatcttggtggtactatgttctggcaagcagatggtgactcaacagatactaacaaatca
ctaattaatgctgtagctaaagtttatgcttctgatacaattaatgtatctgttagcgat
gttactgagaattctgctagtatatcttggaataagccggagttagatggttctatcaag
tatagagtattactgaatggtaaaactatagcagaaaatatcactagccaaagttatgta
cttacaaacttagataaaggtactagatacactatagaagtgattgcaagtacatcaaat
gcttctagagaagatagcataacttttgagacaattggtgcagatgatcaaaacaatgat
caaaataatgatcaaaataataatgctggatcaaccggtaactggaatgcagaagcagtc
tacaataagggtgataaagttattgttaatggtgtgacttatgaagctcaatggtggaca
caaggtaataatccggctgatggtggcgcatggaagaaaccttttgtttcaggtgaggca
tggagtcaaggtcaagcatatactggcggtcaagtagttacataccaaggcgctaaatat
aaagctaaatggtggactcaaggagatattccttcaaatagtaatgtttgggaaaaacaa
taa

DBGET integrated database retrieval system