KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0722cHelp
Entry
FTT_0722c         CDS       T00214                                 

Gene name
isftu1
Definition
(RefSeq) transposase
  KO
K01152  isfu1 transposase
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    FTT_0722c (isftu1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_3 HTH_Tnp_IS630 HTH_29 HTH_33 HTH_40 rve
Motif
Other DBs
NCBI-GeneID: 3191796
NCBI-ProteinID: YP_169736
UniProt: Q5NIH2
Position
complement(join(744289..744747,744747..745073))
Genome map
AA seq 261 aa AA seqDB search
MPSYSQDFRDIVINKHEEGMTEFELSKFFNIDKRTVVSWIEFYKRTGDYSSKQGVGCGRV
ASFTDKTLIEQYLIDHPDASALDIKEALAPDIPRSTFYDCLNRLGFSFKKKTPKYKQRKE
HERLEYIEKLKEIAQNLLFYIDEMGCDNKLSILRGWSLIGEPSYGEVLAYQTQRRSIVAG
YNYADKKIIALLEYSGYTNTEIFNQWFEEHLCPSLKPKTTIVMDNASFHKSSKLIEIANK
FDVQILYLPPYSPDLNPIEKV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgccatcatatagccaagattttagagacatcgtaattaataaacatgaagaaggtatg
acggagttcgagctgagtaagttttttaacatagataagcgtacagttgtttcatggata
gagttttataaaagaaccggagattatagttcaaagcaaggagttggttgtggcagagtc
gctagctttaccgataaaacattgattgaacagtatttgatagatcatccagatgcaagt
gcattagatataaaagaagcattagcccctgatattccaagaagtacattttatgattgt
cttaatagacttggttttagttttaaaaaaaagactccaaaatataagcaaagaaaagaa
catgaaaggttggagtatatagaaaaactaaaagaaatagctcaaaacttgttattttat
atagatgagatggggtgtgacaataagctttctatcctaagaggatggtcactaattggt
gagcctagttatggtgaggttttagcatatcaaacacaaagaagaagtattgttgctgga
tataattatgcagataaaaagattatagctctattagagtacagcggatataccaatact
gaaatttttaatcaatggtttgaggaacacttatgcccatcattaaaacctaaaactact
atagtaatggataatgctagtttccataaatcctctaagctgattgaaatagccaataaa
tttgatgtacaaatattatatctacctccgtactctccagatttaaatcctattgaaaag
gtttag

DBGET integrated database retrieval system