KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0726cHelp
Entry
FTT_0726c         CDS       T00214                                 

Definition
(RefSeq) glycerophosphoryl diester phosphodiesterase family protein
  KO
K01126  glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FTT_0726c
Enzymes [BR:ftu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     FTT_0726c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDPD GDPD_2 PGA_cap PI-PLC-X
Motif
Other DBs
NCBI-GeneID: 3191017
NCBI-ProteinID: YP_169739
UniProt: Q5NGV3
Position
complement(748994..750028)
Genome map
AA seq 344 aa AA seqDB search
MNMFKKITATALTVCSIIIATADVINIYAHRGYRPIAPENTLPAYTEAMRIGVDVIDMDI
NMTKDKVLVVTHDLTLNPDLTKDENGNWITEKTPIKDLTLAQVKKYTVGYIKPDSATAKM
YPNHIGMDNVHMPTLEEVINYVKSNVGSRVRLQIEIKTNPYDLEASWSAQEMAEALNKVL
LKTGMTDNVEVQSFEWQALVDLQKLNPKVKTAYLTDHTTEPMNAEQAKQMANYQKWTAPL
DPKDYNYNYPLMVKKLGGTFWEPFEKDLTKKDVDEAHKLGVKVVTWGWTEDEGSDFNYQV
INNLIDWKVDGIITDRPDILRGVEAAKGLDLPPAYPNIPFPKKF
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgttcaaaaaaattacggcaactgctctaactgtctgtagtattattatagct
actgctgatgtcattaacatatacgcacatagaggatatagacctattgcaccagaaaat
actctacctgcttacactgaagctatgcgtattggtgtagatgttattgatatggatata
aatatgactaaagacaaagttttagttgtaacacacgatttaacattaaacccagatctg
acaaaagatgaaaatggtaattggataacagaaaaaactccaataaaagatctaacctta
gctcaagttaagaaatacacagttgggtatataaaacctgattctgctacggctaagatg
tatccaaatcatattggtatggataatgttcatatgccaactttagaagaggttattaac
tatgtcaaatctaatgttggcagtagagttcgtctacagatagagataaaaactaatcca
tacgatctagaagctagctggtcagcacaagaaatggctgaagctttaaacaaagtttta
cttaaaacaggtatgacggataatgttgaagtacaatcttttgaatggcaggctttagta
gatttacaaaaattaaatccaaaagttaagactgcatatctgacagatcatacaacagag
ccaatgaacgctgaacaagcgaaacaaatggctaattatcaaaaatggacagctccgctt
gatcctaaagactataactataattatccattgatggtcaaaaaactaggtgggacattc
tgggaacctttcgaaaaagatttaactaaaaaagatgttgatgaagctcataaactaggt
gtcaaagttgtaacttggggctggacagaagatgaaggtagtgattttaattatcaagtt
ataaataacctaattgactggaaggttgatggtatcatcactgatagaccagatatacta
agaggtgttgaagcagcaaaaggtttagatttgccacctgcttatcctaatattcctttt
ccaaaaaagttctaa

DBGET integrated database retrieval system