KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0728Help
Entry
FTT_0728          CDS       T00214                                 

Gene name
ybhF
Definition
(RefSeq) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Module
ftu_M00254  ABC-2 type transport system
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ftu02000]
    FTT_0728 (ybhF)
Transporters [BR:ftu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    FTT_0728 (ybhF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 Mg_chelatase AAA_23 Cdc6_C AAA_22
Motif
Other DBs
NCBI-GeneID: 3192154
NCBI-ProteinID: YP_169741
UniProt: Q5NGV1
Position
751119..752051
Genome map
AA seq 310 aa AA seqDB search
MISDKDDQLIIDVKNLTKVYGDKNVVDNISMQVKQGDIYGFLGPNGSGKTTSIRMVCGLL
PITKGEGTCLGYDIGTHASIIKQQVGYMTQKFTLYPDLTVRENLKIFARLHSLKNIKEAV
DKTIDNLQIGKARANQKAYELSGGWKQRLALGVATIHDPKLLLLDEPTAGVDSKARREFW
DYISTLSSKGITTLVSTHYMDEAERCNKLSYIAYGKLLSSGTQKDIIDSCGIKTYNISGK
NVYSLVLELQDNTEIEHVSMFGSSVHLSVKNNVDITHIQTKYEQFEWQSIETSLEDAFIY
LMSSQKDNFA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgataagtgacaaagatgatcaactaataatagatgtcaaaaaccttaccaaagtctat
ggtgataaaaatgtagttgataatatctcaatgcaagttaagcaaggagatatttatgga
tttttaggacctaatggttcaggtaagacaacttctataagaatggtatgtggcttactg
ccaataacaaaaggtgagggtacttgtcttggttatgatataggtactcacgcgagtatt
atcaaacagcaagttggttatatgactcagaaatttacactctatcctgatctgacagtt
agagagaatctcaagatttttgcgagacttcatagtttgaaaaatattaaagaagctgtt
gataagaccatagataacctacaaataggtaaagctagagcaaatcaaaaagcttatgaa
ttatcaggtggctggaaacaacgattagctttgggtgtggcaacaattcatgatcctaaa
ttattactattagatgaacctacagctggagtagattcaaaagcacgtagagaattttgg
gattatatatcaacactatcaagtaaaggtatcacaaccttggtatcaactcactatatg
gatgaagcagaaagatgcaataagttgtcatatatcgcttatgggaaattgttatcaagt
ggcacccaaaaagatattattgatagctgtggtatcaaaacatacaatatttcaggtaaa
aatgtttatagtcttgtgttagagcttcaggataatactgaaattgagcatgtgtcaatg
tttggcagtagtgttcatcttagtgttaaaaataatgttgatattacacacattcaaaca
aagtatgaacaatttgaatggcaatcaatagaaacatcacttgaagatgcttttatatat
ttgatgagtagccaaaaggataactttgcatga

DBGET integrated database retrieval system