KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0729Help
Entry
FTT_0729          CDS       T00214                                 

Gene name
ybhR
Definition
(RefSeq) ABC transporter permease
  KO
K01992  ABC-2 type transport system permease protein
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Module
ftu_M00254  ABC-2 type transport system
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ftu02000]
    FTT_0729 (ybhR)
Transporters [BR:ftu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter [MD:M00254] [OT]
    FTT_0729 (ybhR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3 ABC2_membrane ABC2_membrane_2 ABC2_membrane_4
Motif
Other DBs
NCBI-GeneID: 3192155
NCBI-ProteinID: YP_169742
UniProt: A0A0G2RQ12 Q5NGV0
Position
752048..753166
Genome map
AA seq 372 aa AA seqDB search
MKYFDINRYYAIFLKEVIHMLRDKVTIGLVIGIPLIQLILFGFAINMNPKHLSTAIVNAD
KTLQTNYLIEKINNTGYFDIKYENISRDDATTLMRKGKVQFIIDILPNFTKQVYRGESPN
ILIIVDGANATSNSGALQAVDKVKEIYSQYFSNKQIPQPQSFNFVIHNKYNPENKTQNNI
VPALAGVILTMTMVMVTSLIITREKEYGTMESLLATPVTSLETIFGKITPYIVVGYIQLL
LIIIFAKVIFGITIVGSILLLLIVTFPFIIANLLVGITFSTIADTQLQAMQMTFFFFLPS
ILLSGFMFPFDGMPEWAQVIGNILPLTHYLNIVREILLKGGGFFDILNSIYPLLIFMIVV
SFICIKKYKNTI
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaagtattttgatattaatagatattatgcgatttttctcaaagaggttattcatatg
cttagagataaagtcacaattggattagtgattggtataccacttattcagctaatacta
tttggctttgctataaatatgaatccaaagcatctaagtacagcaatagttaatgctgat
aagacattacaaacaaactatttgattgagaagataaataatactggatattttgacatt
aaatatgaaaatatctcaagagatgatgcgacaacactaatgcgtaaaggtaaggtgcag
tttattatagatatactgcctaattttactaaacaagtttatcgtggtgaatctccgaat
attctaataatagtagatggagcaaacgcaacttcgaattcaggtgctttacaagctgtt
gataaggtcaaagagatatacagtcaatatttttctaataaacaaatacctcagccacag
tctttcaattttgtaatccataataaatataatccagagaataaaacgcaaaataatatc
gtaccagcattagcaggagtgattttgactatgactatggttatggttacatctttgata
atcacgcgcgagaaagagtatggaactatggagtctcttcttgcaacacctgtaacatct
cttgagactattttcggtaagattactccatatattgttgttggctatattcagttatta
ttgattattatatttgctaaggtgatatttggaataaccatagttggtagtattttatta
ttacttattgtaacttttccttttattattgcaaatctcttggtaggtattacattctca
actattgctgatacacaattacaggcaatgcaaatgacatttttctttttcttgccatcg
atattactgtcaggttttatgtttccatttgatggtatgccagagtgggcacaagtcata
ggtaatattttaccattaactcattatctaaatattgtccgagaaattcttcttaaagga
ggagggttttttgatattctaaacagcatttatccacttttaatttttatgatagtagtt
tctttcatatgtataaaaaaatacaagaatactatttag

DBGET integrated database retrieval system