KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0732Help
Entry
FTT_0732          CDS       T00214                                 

Definition
(RefSeq) hypothetical protein
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CM_2
Motif
Other DBs
NCBI-GeneID: 3192185
NCBI-ProteinID: YP_169745
UniProt: A0A0G2RNZ9 Q5NGU7
Position
754790..755137
Genome map
AA seq 115 aa AA seqDB search
MKKYLIMALCLAFYSSSFAMAQNNVAKPSVENYKTKIMNIDQQIIQLIAERRGWRDKMLK
LEKKQNLPSYDPFKDQSLANTCTSFAIQYDVSPKLVAEVFDILNNKNLQPADQSF
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatacctaataatggctctctgccttgctttttacagttcatcatttgcaatg
gcacaaaataatgtggctaagccttcggttgaaaactataagactaagattatgaatatt
gatcagcaaattatacaattaattgctgagcgtcgtggctggagagataaaatgttaaag
cttgagaaaaagcaaaatttaccaagttatgatccatttaaagatcaatcattagctaat
acatgtacatcatttgcgatacagtatgatgtttctccaaagttggttgctgaagttttt
gatattttaaataacaaaaatttgcaaccagcagatcaaagtttttaa

DBGET integrated database retrieval system