KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0736Help
Entry
FTT_0736          CDS       T00214                                 

Definition
(RefSeq) hypothetical protein
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF676 PGAP1 DUF900 Hydrolase_4 DUF915 Abhydrolase_6 Palm_thioest Abhydrolase_1 Abhydrolase_5 LCAT PGBA_N Ser_hydrolase
Motif
Other DBs
NCBI-GeneID: 3192180
NCBI-ProteinID: YP_169747
UniProt: Q5NGU5 A0A0G2RNQ3
Position
757924..758571
Genome map
AA seq 215 aa AA seqDB search
MKTDKVIVLVHGFIKNAKDMRSLVSYLKQDYDDIVAVDLPTTFVSMDVAVSKLCQIIQNI
PKTKSITFIAHSMGGILVCKCIDKLQLDNIDKCVFIATPFAGSKVADFGDRIPFYSRILK
PNKELKVTDDYLEICNKVAAMVPIGLIAGNKHSKFNLLAKFCLKNDHDGLVEVASVFAVN
SAYRIVLYKNHCKIHHDDETLSKIACFLQTGKFKI
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagataaagttatagttttagtgcatggatttatcaaaaatgctaaagatatg
cgtagtttagtaagttatctaaagcaggattatgatgatattgtagctgtggatttacca
actacatttgtaagtatggatgttgcagttagcaaactttgtcaaattatacaaaatatc
ccaaagacaaaatctatcacttttatagcacatagtatgggtggtatattagtttgcaag
tgtatagataaactgcaacttgataatatagataaatgtgtatttatagcgacaccattt
gcagggtcaaaagttgctgatttcggcgatagaattccattttattctaggatactaaaa
ccaaataaagaattaaaagttactgatgactaccttgagatttgtaataaagttgcagct
atggttccaataggtctaattgcaggaaataaacactcaaaatttaatctattagctaaa
ttttgtctaaaaaatgatcatgatggtttggttgaagtagcatctgtttttgcggtaaat
agtgcatataggattgtcttatacaaaaaccactgcaagattcatcatgatgatgagaca
ctaagtaaaatagcttgttttttacaaactggtaaatttaaaatctaa

DBGET integrated database retrieval system