KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0747cHelp
Entry
FTT_0747c         CDS       T00214                                 

Definition
(RefSeq) hypothetical protein
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 Biotin_lipoyl Cass2
Motif
Other DBs
NCBI-GeneID: 3191854
NCBI-ProteinID: YP_169758
UniProt: Q5NGT4
Position
complement(769162..769947)
Genome map
AA seq 261 aa AA seqDB search
MGINMSNKNTKSIISIIIILFALFSLYAMWQYYLYSPWTRDGRIRAKIITIAPDVSNMYV
SDNQKVKKGQLIFTIDDQRYAATLEGKEAELKHAMIEWQLAEKQYLRRIRLGRDDSISRE
ELDDYAMQEKLRKADLEKAKAEAELAKINLDRTKIYAPADGTINNIDLRQGNYVVSSKPV
MSLVKAGSFYVTGYFEETKLPHIKIGDKAKIILMSGGEPLYGHVISIGKAVTDNNTDVNN
QLLPKVQETYDWVRLSKRIDR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
ttggggattaatatgtcaaacaaaaatactaaatctataatcagtataataattatttta
tttgctcttttttcactgtatgcaatgtggcaatattatctttattcaccttggacaaga
gatggtagaatccgcgcaaaaattatcacaatagcacctgatgtatcaaatatgtacgtc
agtgataaccaaaaagttaaaaaaggacagctaattttcacaatagatgaccaaagatat
gctgcaactctagaaggtaaagaagcggaattaaaacatgccatgatcgaatggcagctt
gcagaaaagcagtatttaagaagaattagactaggcagagatgactcaataagtagagaa
gagctagatgattatgcaatgcaagaaaaactaagaaaagctgatcttgaaaaagccaaa
gctgaagctgaattagctaagattaacctagacagaacaaagatatatgctcctgctgat
ggaactatcaacaacattgacctaagacaaggcaattatgtagtatcttctaaaccagta
atgtctttagtaaaagctggctcattttatgtcaccggatattttgaggaaactaaacta
ccgcatattaaaataggtgacaaagccaaaataatacttatgagtggtggagagccatta
tatggacatgtgataagtataggtaaggcagtcactgataataatactgatgtaaataat
caacttttacccaaagtacaagaaacctatgactgggtaagactatccaaaagaattgat
agatga

DBGET integrated database retrieval system