KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0749cHelp
Entry
FTT_0749c         CDS       T00214                                 

Definition
(RefSeq) hypothetical protein
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 COesterase Peptidase_S9 LIP Hydrolase_4 Abhydrolase_2 Peptidase_S15 BAAT_C
Motif
Other DBs
NCBI-GeneID: 3191849
NCBI-ProteinID: YP_169760
UniProt: A0A0G2RM24 Q5NGT2
Position
complement(771106..772092)
Genome map
AA seq 328 aa AA seqDB search
MFKNNNIMSFFIIIVLIITGIFLYIKNKANNQYQILPDNSGSSLTDTSWIKNKYLNIPYA
SSSNAQKLDIYLPNDKSFAKPYPVIIAIHGGAFLGGDKADYQLKPMLEGIKHGYAVVSVN
YRLANEAKFPAQIQDIKAAIRFIKANANKYNLNPNAIAVWGDSAGANLAALAATSGNKIT
KLDDLSLGNKDYSANVQACVDWFGPTDFSKMDDQFRQSGLGKPIHSQNDSPENLYIDSNV
ANSPQKVKMANPETYISKDTPPFLIEHGSVDNVVPVQQSINFYKKLVKTIGKDKLELVII
DDAKHGGEKFESKSNLELVFKFLDKYLK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaataacaatataatgagtttttttataataatcgtattgataataaccgga
atatttttatatataaagaataaagctaataaccaatatcaaatacttcctgataacagt
ggatctagcttaaccgatacctcttggattaaaaacaaatatctaaatataccttatgct
tcatcatcaaatgcgcaaaaactagatatttatttacctaatgataaaagttttgctaaa
ccgtatcctgttataattgctatacatggtggcgcattcttaggtggtgataaggctgac
tatcaactaaagcctatgcttgagggcattaaacatggttatgctgtagtttcagtaaat
tatcgcttagctaacgaggcaaaatttccagctcaaatccaagatatcaaagcagctatt
agatttatcaaagcaaatgctaataaatacaatctaaatccaaatgctatagctgtttgg
ggagattctgctggggctaatttagcagctcttgctgccacatctgggaacaaaataact
aagctagatgacttaagtttaggtaataaagattattcagcaaatgtacaggcttgtgtt
gactggtttggacctacagattttagcaaaatggatgatcaatttagacagtctggctta
ggtaagccaattcattcacaaaatgattcacctgagaacttatatatcgatagtaatgta
gctaatagtcctcaaaaagtcaaaatggctaacccagaaacatatataagcaaagatact
cctccttttcttatagaacatggcagtgttgataatgtcgtgcctgtccaacaaagtata
aatttctataaaaaattagttaagacgataggaaaggacaagcttgaattagtaattatt
gatgatgctaaacatggtggagaaaaatttgaaagcaaaagcaacttagaacttgtattt
aaattccttgataaatatcttaaataa

DBGET integrated database retrieval system