KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_0750Help
Entry
FTT_0750          CDS       T00214                                 

Definition
(RefSeq) hypothetical protein
  KO
K19810  L-lysine 2,3-aminomutase [EC:5.4.3.-]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:ftu03012]
    FTT_0750
Enzymes [BR:ftu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.-  
     FTT_0750
Translation factors [BR:ftu03012]
 Prokaryotic Type
  Elongation factors
   FTT_0750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_12 Fer4_14
Motif
Other DBs
NCBI-GeneID: 3191848
NCBI-ProteinID: YP_169761
UniProt: A0A0G2RP35 Q5NGT1
Position
772298..773284
Genome map
AA seq 328 aa AA seqDB search
MSTNDWKKVLKESFSSPLELLEFLEIDSEEAKVSLNIAKKFKMIVPRSFADRMQKGNIND
PLLKQVLPTADEEVIDQAYSSDPLDEKNYNKVPGLLHKYHGRVLLIAQTSCAVHCRYCFR
KEFDYKENIPGRKDWLQAFEYIANDQSIEEVILSGGDPLLNNDEILEFFIENIQRISHIK
RLRIHSRIPVVLPERITTKLLKILSEHRLDTVLVIHVNHPNELDGNVSKVLKEIHKHGII
ILNQSTLLKDINDDANVLYALSTKLINAKVIPYYIHSLDTVSGTKHYNVDNDKDIMKKLS
EISSGFMVPVLTKEIPGYPSKKWLSFHS
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtctactaatgattggaaaaaagtacttaaagaatctttctcttcacctttagaatta
ttagagtttttggaaatagatagtgaagaagccaaagtttcattaaatatagccaagaag
tttaaaatgatagtgcctagatcatttgctgatagaatgcaaaaaggtaatatcaacgat
cctttgctcaaacaagttttgccaactgccgatgaggaagtgatagatcaagcctatagt
agcgatccacttgatgaaaaaaactataataaagttcctgggttactacacaaatatcat
ggtagagttctgctgatagcacaaacaagctgtgcggtgcattgtcgctattgttttcgt
aaagagtttgactataaagaaaatatccccggtagaaaagattggttgcaagcctttgaa
tatatagcaaatgaccaaagtatcgaggaagtcatattaagtggaggagatcctctctta
aataacgatgaaatattagaattttttatagaaaatatccagcgaatatctcatatcaaa
aggcttagaattcattcaagaatacctgtagtgctaccagagcgaatcactactaaactt
ttgaaaattctttcagagcatagacttgatactgtattagtaatacatgtgaatcatcca
aatgagctagatggtaatgttagtaaagttttaaaagaaatacataaacacggcataatt
atcctaaatcaaagtacattacttaaagatataaatgatgatgctaatgtattatatgct
ttgagtacaaaacttataaatgcaaaagtaattccatactatatacattcactagatact
gtctcagggactaaacactataatgttgataatgataaagatattatgaaaaagctttca
gaaatttcatcaggatttatggtgcctgtgttgaccaaagaaattccaggatatccatcg
aagaaatggctatcttttcatagctaa

DBGET integrated database retrieval system