KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_1226cHelp
Entry
FTT_1226c         CDS       T00214                                 

Gene name
iscS
Definition
(RefSeq) cysteine desulfurase
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu00730  Thiamine metabolism
ftu01100  Metabolic pathways
ftu04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    FTT_1226c (iscS)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    FTT_1226c (iscS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ftu03016]
    FTT_1226c (iscS)
   03029 Mitochondrial biogenesis [BR:ftu03029]
    FTT_1226c (iscS)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ftu02048]
    FTT_1226c (iscS)
Enzymes [BR:ftu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     FTT_1226c (iscS)
Transfer RNA biogenesis [BR:ftu03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    FTT_1226c (iscS)
 Prokaryotic Type
    FTT_1226c (iscS)
Mitochondrial biogenesis [BR:ftu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    FTT_1226c (iscS)
Prokaryotic defense system [BR:ftu02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   FTT_1226c (iscS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1 Cys_Met_Meta_PP Pyridoxal_deC B12-binding Methyltransf_34
Motif
Other DBs
NCBI-GeneID: 3191911
NCBI-ProteinID: YP_170184
UniProt: Q5NFK8 A0A454XL75
Position
complement(1242208..1243383)
Genome map
AA seq 391 aa AA seqDB search
MSLIYLDYAATTPLSQSVKNSMLNSITSDDDFFNSGSLTYQQAEIVSNKIEQARATIAQT
LEVLPREVIFTSGATESNNLAIKGVAYAYKDRGRHIITSKAEHKAVLDVCKFLETQGFDV
TYLDVNQFGEVDLEQLKKAITPQTILVSLMAVNNELGTKNNLIEIGKITKQKGVMLHVDA
AQGYGKVDIDIKAMNIDLLSVSGHKLYAPKGVGFLYLRSKRPKVRLVKQIHGGAQEFNLR
AGTLATYQIFALAIAVKEMFAKKQQNFEYVLEMRRVFLDIIQDLASIKINTDLENSYPGI
LSVTFLGVKGETLLALVDGVCMSMGSACNSQAVEPSHVLSAIGLTATQAESTLRISFGLQ
TNKKQVIQAANLLKEKVQLLRALSPQGEVNV
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttatttatttagattatgctgcgacaactcctcttagtcaaagtgtcaaaaac
tctatgttaaactctataactagtgatgatgatttttttaattctggatcattgacatat
caacaagcagaaattgttagtaataaaattgaacaagcaagggctacaattgcacaaact
ctagaggtattaccaagggaggtcatttttacatcgggagcaacagagtcaaataacctt
gcgataaaaggagtagcatatgcatataaagatagaggcagacatataataacatcaaaa
gctgagcataaggcagtattagatgtatgtaagtttttagagacacaggggtttgatgtt
acataccttgatgttaaccagtttggtgaggttgatttagagcagcttaaaaaagctatc
acgccacaaacaatacttgtaagtttaatggctgtaaataatgaactcgggacaaaaaat
aatcttatagaaattggtaaaataaccaagcaaaagggcgtgatgctgcatgttgatgct
gcccagggttatggcaaagttgatatagatatcaaagcgatgaatattgatctattatca
gtgtctgggcataagttatatgcaccaaaaggtgttggttttttgtatctaagatcgaaa
cgaccaaaagttaggcttgtaaagcaaatacatggaggggctcaagagtttaatttacgc
gcagggacattagcaacctatcagatatttgcattagctatagccgttaaagagatgttt
gctaaaaaacaacaaaactttgaatatgtgttagaaatgcgtcgagtttttttagatatt
attcaggatttggctagtataaaaattaatacagatcttgagaatagttacccaggtatt
ttaagtgtgacatttttaggagtaaaaggtgaaacgctattagcattagttgatggggtt
tgtatgtcaatgggctcagcgtgcaattctcaggcagttgagccttcacatgtgttaagt
gccataggtttgacagcaactcaagcagagtcaacacttagaatatcttttgggttacaa
acaaataaaaagcaagttattcaagcggcaaatttgctaaaagaaaaagtacaactttta
cgagctttatctcctcaaggagaagtaaatgtataa

DBGET integrated database retrieval system