KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_1352
Entry
FTT_1352          CDS       T00214                                 

Definition
(RefSeq) hypothetical protein
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
SSDB
Other DBs
NCBI-GeneID: 3191588
NCBI-ProteinID: YP_170304
UniProt: A0A454XIQ8 Q5NED0
Position
1390905..1392056
AA seq 383 aa
MSQIISTLNNIDLVTQDKVNLISNMQIQAKYENAEYKSFIDQLIDNLNTTRSIDIYNLFL
SLNSEICLNLDTVDNISKIISSYLSILNTNFTRISPSESKQKNQLAEKGINKFLVTMDAN
FAQMQNQDKLLPNNIDSIIEIVQEVIIFFEKNNLNYNSDFKIQLNKTLRKIKSSLILKDQ
KNDTYSDKESINQVEATITDQKTIQGSEKWKTLIEKIEVLKALVESERIFETSIVYNDIQ
NLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDYYSSSIQWSIAQKMYNIDYKSFLDT
LEKMPENNFLNSSSDITKNFFYETSSEVEKTPIEEHKIIADTDAIKEEIVIKQRTNNKKN
QNDPVEKISNKIDEDYFEDLFDI
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgagtcagataatatctacactaaataatattgatttagtaactcaagataaagtaaat
ctgattagtaatatgcaaatacaagcaaaatatgaaaacgctgagtataagtcatttatt
gatcaattaatagataatcttaatactactagaagcatagatatatataacttatttcta
tctttaaattcagaaatatgcctcaatttagatacggttgataatatctctaaaattatt
agctcttatttatctattctaaatactaatttcacaagaattagtccatcagaatcaaag
caaaaaaaccagctagctgaaaaaggaataaacaaattcttagtcactatggatgcaaat
tttgcgcaaatgcagaatcaagacaagttgttaccaaataacatagattctattatagaa
attgtacaggaagtaataatattttttgagaaaaataacttaaattataattctgatttt
aaaatccaactaaataagactctcagaaaaataaaaagttctttgattttaaaagatcaa
aaaaatgatacgtattccgataaagaatcaataaatcaagttgaagcaactatcacagat
caaaaaaccatacaaggctctgagaaatggaaaactcttattgaaaaaattgaagtttta
aaagctctagttgaaagtgaaagaatatttgaaacatctattgtttataatgatatacaa
aacttattagttaacttcgatcctaaagagtattttccagaaattttctttccattatac
aagaagatagctccttttattggcaatatccataaaaacatagactactactcatcaagt
attcagtggagtatagctcagaagatgtacaacatagattataagagttttttagatact
cttgagaaaatgcccgaaaataattttttaaattcttcttctgatataactaaaaatttc
ttttatgaaacatcctcagaggtggaaaaaactcctatcgaagaacataaaataattgca
gatacagatgctatcaaagaagaaatagtaataaaacagcgaaccaataataaaaaaaac
cagaatgaccccgtagaaaaaatttcaaataaaatagatgaagactattttgaagatctt
tttgacatataa

DBGET integrated database retrieval system