KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_1484cHelp
Entry
FTT_1484c         CDS       T00214                                 

Gene name
aceF
Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu00010  Glycolysis / Gluconeogenesis
ftu00020  Citrate cycle (TCA cycle)
ftu00620  Pyruvate metabolism
ftu01100  Metabolic pathways
ftu01110  Biosynthesis of secondary metabolites
ftu01120  Microbial metabolism in diverse environments
ftu01130  Biosynthesis of antibiotics
ftu01200  Carbon metabolism
Module
ftu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ftu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTT_1484c (aceF)
   00020 Citrate cycle (TCA cycle)
    FTT_1484c (aceF)
   00620 Pyruvate metabolism
    FTT_1484c (aceF)
Enzymes [BR:ftu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FTT_1484c (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 RnfC_N NQRA HlyD_3 PTS_EIIA_1 HlyD_D23 DUF2118
Motif
Other DBs
NCBI-GeneID: 3192412
NCBI-ProteinID: YP_170419
UniProt: A0A454XU09 Q5NEX3
Position
complement(1534311..1536206)
Genome map
AA seq 631 aa AA seqDB search
MSIEIVKVPDIGDYDNVDVIEVNVAVGDVIAEEDSLITLETDKASMEVPSPFAGKITKLT
VKVGDKVSQGTAIMEVEVESAADQAATTQSQPQTTSSAPVAATTNLIVDVEVPDIGDYDS
VDVIEVSVKVGDEIAEEDSLITLETYKASMEVPSPVAGKVVEVITKVGDKVSQGSLILKV
ETGSSAQAPAQEQSQQSAPVKSAAEEIIDVKVPDIGDYDSVDVIEVSVAVGDKIEEEDSL
ITLETDKASMEVPSPVAGEVVEIITKVGDKVSQGSLILKVKTQGSAPVEQTSSQPAPAKQ
EQAKQQAATPAAPTPASSSVNEYAVDNSNAHASPAVRKLARILNIDLSKVKATGRKGRVT
KEDCYNYIKHAVTQVQTGKVAASGSGLDLLDDPVVDFAKFGEIETQPLSRINKISAKNLH
RNWVKIPHVTFYDDADVTDLEEFRNAKKAFAEKKGIKITPLSFLVKAAAVALQEFPRFNS
SLSNDGENLIIKKYYNIGFAADTPAGLMVPVVKDADKKGIIEISKDIMELAGKARDGKLG
AKDMTGATFTISSLGVLGTTSFTPIINMPEVAIMGVSKTAVKPIWNGKEFIPRTMLPLSL
STDHRVIDGALAAKFLTRYCQILSDLREIIM
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagagatagttaaagtccctgatattggggattatgataacgttgatgtgatc
gaggttaatgttgctgtaggtgatgttattgctgaagaagattcactaattacgttagaa
acagataaagcaagtatggaggttccatctccatttgcaggtaagatcactaaattaact
gtaaaagttggtgataaagtttctcagggaactgcaataatggaagttgaggttgagagt
gctgctgatcaagctgctactacacaatcacaacctcaaacaactagttcagctcctgta
gctgctacgacgaacctgattgttgatgtcgaggttccagatattggcgactatgatagt
gttgatgtgattgaggtgtctgtaaaagtaggtgatgagatagcagaagaggattcgcta
attacgcttgaaacatataaggctagtatggaagtaccatcgcctgtagcgggtaaggtt
gttgaagttattactaaggttggtgacaaggtttcacaaggtagcttgattttaaaggtt
gaaacaggctctagtgcacaagctccagctcaagaacagtcacaacaatctgcaccagtt
aaatccgctgctgaagaaattattgatgtaaaagttcctgatatcggtgattacgatagt
gttgatgtgattgaagtatctgtagctgttggtgataagattgaagaagaagattctttg
attacattagaaactgataaggcaagcatggaggttccgtctccagttgctggtgaagtt
gttgaaataatcacaaaagttggtgataaagtttcacaaggtagtttaattcttaaggtc
aaaacacaaggttcagcaccggtagagcaaactagttcacaaccagcgccagctaaacaa
gagcaagctaaacagcaagctgctacacctgctgctccaacgccagcatcaagttcggta
aatgagtatgctgtagataattctaatgcacatgcgtctcctgcagtgagaaagctagca
cgaattctaaatattgatctaagtaaggttaaagctacagggcgtaaaggtcgtgtaaca
aaagaagattgttataactatattaagcatgctgtcacacaagttcaaactggtaaggtc
gctgctagtggtagtggtttagatcttttagatgatcctgttgttgattttgctaagttt
ggtgagattgaaactcaaccattatcaagaattaacaagattagtgctaagaatttacat
cgtaactgggtgaagattcctcatgttacattctatgatgatgcggatgtcacagactta
gaagagttcagaaatgctaagaaagcctttgctgagaaaaaaggtattaagattacacct
ttatcattcttggttaaagctgctgcagttgcattacaagagttcccaagatttaatagc
tcattatcaaatgatggtgagaacttaattatcaagaagtattataatattggttttgct
gcagatactccagctggtttaatggttccagttgtcaaagatgctgataaaaagggtatc
attgaaatatcaaaagatattatggagttggctggcaaagctcgtgatggtaaacttggc
gcaaaggatatgacaggtgctacatttactatctcaagcttaggcgtgttaggtactacg
tcatttacgcctattataaatatgccagaggtggctattatgggtgtatctaagacagca
gtgaagcctatttggaatggtaaagagtttattcctagaactatgctaccattatcatta
tctacagatcatagagtgatagatggcgcattagcagctaaattcttaactagatattgt
cagattttatctgatttacgtgaaatcataatgtaa

DBGET integrated database retrieval system