KEGG   Francisella tularensis subsp. tularensis SCHU S4: FTT_1773cHelp
Entry
FTT_1773c         CDS       T00214                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ftu  Francisella tularensis subsp. tularensis SCHU S4
Pathway
ftu00260  Glycine, serine and threonine metabolism
ftu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ftu01100  Metabolic pathways
ftu01110  Biosynthesis of secondary metabolites
ftu01130  Biosynthesis of antibiotics
ftu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ftu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTT_1773c (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FTT_1773c (trpB)
Enzymes [BR:ftu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FTT_1773c (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 3190984
NCBI-ProteinID: YP_170663
UniProt: Q5NE79 A0A0H3TNQ1
Structure
PDB: 

Position
complement(1862543..1863733)
Genome map
AA seq 396 aa AA seqDB search
MSKLNAYFGEYGGQFVPQILVPALDQLEQEFIKAQADESFKQEFKELLQEYAGRPTALTK
TRNIVKNTRTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVATAL
ACALLDLKCRVYMGAKDVERQSPNVFRMKLMGAEVIPVHSGSATLKDACNEALRDWSANY
SKAHYLLGTAAGPHPFPTIVREFQRMIGEETKQQMLAKEGRLPDAVIACVGGGSNAIGMF
ADFIDEKNVKLIGVEPAGKGIETGEHGAPLKHGKTGIFFGMKAPLMQNSDGQIEESYSIS
AGLDFPSVGPQHAHLLAIGRAKYASATDDEALDAFKLLCKKEGIIPALESSHALAHALKL
AYEDPNKEQLLVVNLSGRGDKDIFTVHDILKEKGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaactaaatgcttattttggtgagtatggtggtcaatttgtaccacaaatactt
gtcccagctcttgatcaactcgagcaagaatttataaaagcacaagctgatgaatctttt
aagcaagaatttaaagagcttttgcaagagtatgcgggtcgccctactgctcttacaaaa
actagaaatatagtcaaaaacacaagaaccaagctctacctaaaacgcgaggatctacta
catggcggcgctcataaaaccaaccaagtacttggtcaagctctactagccaagagaatg
ggtaaaaaagagataattgcagaaactggagctgggcaacatggtgttgctactgctttg
gcttgcgcactacttgatctaaaatgtagagtatatatgggtgctaaggatgttgaacgc
caaagccctaatgtctttagaatgaaattaatgggtgctgaagtcatacctgtacatagt
ggctcagctactcttaaagatgcttgtaacgaagcactaagagattggtcagcaaactat
agtaaggctcattacctactaggtactgccgctggacctcatccttttccgacgatagtt
agggaatttcaaagaatgattggtgaagaaaccaaacaacaaatgcttgctaaagaaggt
agactacctgatgctgtgattgcttgtgttggaggtggctcaaatgctatcggtatgttt
gctgactttattgatgaaaaaaatgtcaagcttataggtgtagaacctgctggtaaaggt
atcgaaactggtgagcatggagctccgcttaaacatggtaaaactggtatattttttggt
atgaaggcaccactaatgcaaaactcagacggacaaattgaagagtcatactctatatca
gctggtctggattttccatctgttggacctcaacacgctcatttattagcaataggtcgt
gctaaatatgcatctgctacagatgatgaagcgttagatgcttttaaattactctgtaaa
aaagaaggaattatcccagctctagaatcatctcacgccctagcacacgctcttaaactt
gcttatgaggatcctaataaagagcaacttttggttgttaatctatctgggcgtggtgat
aaggatatttttacagtgcatgatattttaaaagaaaagggagagatttaa

DBGET integrated database retrieval system