KEGG   Francisella tularensis subsp. holarctica VT68: CH67_1999Help
Entry
CH67_1999         CDS       T03714                                 

Gene name
argS
Definition
(GenBank) arginine--tRNA ligase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
ftv  Francisella tularensis subsp. holarctica VT68
Pathway
ftv00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ftv00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CH67_1999 (argS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ftv01007]
    CH67_1999 (argS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ftv03016]
    CH67_1999 (argS)
   03029 Mitochondrial biogenesis [BR:ftv03029]
    CH67_1999 (argS)
Enzymes [BR:ftv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     CH67_1999 (argS)
Amino acid related enzymes [BR:ftv01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   CH67_1999 (argS)
Transfer RNA biogenesis [BR:ftv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CH67_1999 (argS)
 Prokaryotic type
   Other AARSs
    CH67_1999 (argS)
Mitochondrial biogenesis [BR:ftv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CH67_1999 (argS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1g tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: AJI65379
UniProt: A0A0B6D0F6
Position
1750033..1751778
Genome map
AA seq 581 aa AA seqDB search
MNIENYLSETLAKVFQKLGYAESFAKVVTSTREDVGHFQCNGAMPLAKFAKKPPLAIAEE
IVEHIDAEDIFAKLEVAKPGFINITLAPKFLADTTNRFLNSNKFGVQNNLPNRKVVLDFG
GPNVAKPMHVGHIRSALLGDALQRIHRFCGDTVISDVHLGDWGTQMGMLIEEIKLQSPQL
VYFDENYTGEYPTESPITVQELAEIYPRASKRCKSDINEMEKARLATFELQQGRRGYVAL
WQHFVRISIDAVKKDFDSLDVHFDLWLGESDANKFIDEMISYFQANNFIYEDEGAWVIDT
NKDGVPPLIVIKKDGGVMYGTTDLATLWQRSKDLDPDEIIYVVDKRQSLHFKQVFSVAER
TKVVSEKCKLKHVAFGTVNGKDGRPFKTREGGVMHLADLISQAKEYAKNRMPDENDDSII
DQIAMATIKFGDLINNYANDYFFDLEKFAQHEGKTGPYLLYTVVRAKSILRKIFGDNYDI
KSLAKDYKVVNAHNEYEEKLQLQLIQFPIAVQRAYENSQPHHICEYAYSLANSFNKFYVN
CPINNLDDESLKKARIALCMATVKAMTIASDLIGISIPERM
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagaaaattatttatcagaaactcttgcaaaggtgttccaaaagctaggttat
gcagaaagttttgctaaagttgtaacctcaactcgtgaagatgttggacatttccagtgt
aatggcgctatgccattagctaaattcgccaaaaaaccgcctttggcaattgccgaagag
atagtcgagcatattgatgctgaagatatctttgccaaattagaggttgctaaaccaggc
tttatcaatataactttagcaccaaaattcttagctgatactacaaatagatttttaaat
tctaataaatttggtgtacaaaacaacttacctaataggaaagttgtgcttgattttggt
ggtccaaatgttgctaagccgatgcacgttggacacattagatctgcacttttaggtgat
gccttacaaagaattcatcgcttctgtggtgatacggtaatctctgatgtacatttaggt
gattggggtacgcaaatgggtatgcttatagaagaaataaaactacaatcgcctcaactt
gtatattttgatgaaaattatacaggtgaatatcctactgaatcaccaataactgtccaa
gagctagcagaaatctatccgcgtgcctcgaagaggtgtaaatctgatataaatgaaatg
gaaaaagctagattagctacttttgaattacaacaaggtcgtagaggttatgttgcactt
tggcaacattttgtgagaatctctatcgatgcagttaaaaaagattttgatagtttagat
gtgcattttgacttatggttaggtgaaagtgatgctaataaatttatcgatgaaatgatt
agttactttcaagctaataattttatctatgaagatgaaggtgcttgggttattgacaca
aataaggatggagtaccacctctaatagtcatcaaaaaagatggtggtgtaatgtatggt
actacggatctagctactttatggcagcgtagcaaagatcttgatccagatgaaataatt
tatgtagttgacaaaagacaatctcttcactttaagcaagtttttagcgttgctgaacgg
acaaaagttgtcagcgaaaaatgcaaacttaaacacgtggctttcggcacagtcaatggt
aaagatggacgccctttcaaaacccgtgaaggtggcgtaatgcatttagcagatttgatt
tctcaagcaaaagaatatgccaaaaatagaatgcctgatgagaatgatgatagcattatt
gatcaaatagctatggcaacaattaaatttggtgacctaatcaataactatgctaatgat
tatttctttgatttagaaaagtttgcacagcatgaaggtaaaacaggtccttatcttttg
tatactgtagttagagcaaaatcgatccttagaaaaatatttggtgacaactatgatatc
aaatctctagcaaaagattataaagttgtaaatgctcataatgaatacgaagaaaaactc
caacttcaactaatacaatttcctatcgctgtacaaagagcttatgaaaattcgcaacct
catcatatttgcgagtatgcttactcattagctaatagttttaacaaattctacgttaat
tgccctattaataatcttgacgatgagtcattaaaaaaagcaagaattgcactatgcatg
gcaactgtcaaagctatgacaatcgcttcagatttaataggcatctctattcccgagaga
atgtaa

DBGET integrated database retrieval system