KEGG   Francisella tularensis subsp. holarctica VT68: CH67_429Help
Entry
CH67_429          CDS       T03714                                 

Definition
(GenBank) acid phosphatase
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
ftv  Francisella tularensis subsp. holarctica VT68
Pathway
ftv00562  Inositol phosphate metabolism
ftv00564  Glycerophospholipid metabolism
ftv01100  Metabolic pathways
ftv01110  Biosynthesis of secondary metabolites
ftv02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ftv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CH67_429
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CH67_429
   00565 Ether lipid metabolism
    CH67_429
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    CH67_429
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:ftv02042]
    CH67_429
Enzymes [BR:ftv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     CH67_429
Bacterial toxins [BR:ftv02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   CH67_429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: AJI65439
Structure
PDB: 

Position
387730..388671
Genome map
AA seq 313 aa AA seqDB search
MNNSKPNDYGTLVKIEQKLFNNANTLKTTTPIKHVVIIFQENNSFDRYFGMYPNAKNPEG
EPKFVAKENTPNVNGLTKQLLENNPNTKNPYRLDRNFQPCSQNHEYHQEISSFNGGLMNK
FVEHGGHDNDTYKQNCDGQVMGYYDGNTVTALWNYAQNFALNDNTFGTTFGPSTPGALNL
VAGANGPAMSPSGNLENIENSYIIDDPNPYYDDCSYGTSKSGDTNTAVAKITDGYNIGHY
LTQKGITWGWFQGGFKPTSYSGKTAICDAMSTNKFGIKSRDYIPHHEPFNYWKETSNPHH
LAPSDDKYIGSND
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgaataatagcaaaccaaatgattatggaactcttgtaaaaatagaacaaaaattattt
aataatgcgaatactctaaaaactacaactccaataaagcacgtagtaataatattccaa
gagaataactcttttgatagatactttggaatgtaccctaatgccaaaaacccagagggt
gagccaaaatttgtagccaaagaaaatactccaaatgttaatggtctgacaaaacaatta
ttagagaataatccaaatacaaaaaatccttatcgtttagatagaaatttccaaccttgc
tcacaaaatcatgagtaccatcaagaaatttcttcttttaatggtggattaatgaacaaa
tttgttgaacatggtggtcatgataatgacacctataaacaaaactgtgatggtcaagtc
atgggatattatgatggtaatactgtcacagcattatggaattacgcacaaaatttcgct
ctaaatgataatacgtttggtacaacttttggtccatcaacacctggtgctcttaaccta
gtggctggtgcaaatggtccagcaatgagtccaagtggtaatttagaaaatattgaaaac
agctatatcattgatgatcctaacccatactacgatgattgctcttatggtacaagtaaa
tctggcgatacaaatacagctgtagcaaaaattactgatggttataatattggacactat
ctaactcaaaaaggtattacttggggttggttccaaggaggattcaaaccaacaagctac
tctggtaaaacagcaatatgtgatgctatgagcactaataagttcggtataaaatcaaga
gactatatacctcatcatgagccttttaactactggaaagagacatcaaaccctcatcat
ctagcaccaagtgatgataagtatataggtagtaatgactaa

DBGET integrated database retrieval system