KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0042
Entry
FTW_0042          CDS       T00495                                 

Definition
(GenBank) hypothetical protein
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
SSDB
Other DBs
NCBI-ProteinID: ABO46046
Position
complement(38001..38576)
AA seq 191 aa
MSKKIFKLLSISIIFSIYQQTFSNTITASTFELKNSSKKNATIFLNLNEFCPTNIAACKD
ENDNNCIYITELVREPLSRIYYYLAVPITSKSVKDLTILYKHDKEESPPEAINICLSLFK
NNKHETYYSQVIYNWFVSSELYLSFSEGSIFINKDINNSNNYDKGNFLSVNLERIADGWA
PPHYEKKITII
NT seq 576 nt   +upstreamnt  +downstreamnt
atgagtaaaaaaatatttaaattattatcaatttcaataatatttagtatatatcaacaa
acatttagtaatacaataacagctagtacattcgaactaaaaaatagttctaaaaaaaat
gctactatctttctaaatttgaacgagttctgtccgactaatatagcagcatgcaaagat
gagaatgacaataattgtatttatataactgaattagttagagaacctcttagtcgtatt
tactattacttagccgtgccaattaccagcaaatcagttaaagacttaacaatattatat
aaacatgataaagaagaatctccaccagaagcaataaatatatgtttgagtttatttaaa
aataataagcatgaaacatactattctcaagttatatataattggtttgtatcttcagaa
ttatatttatcatttagtgaaggatctatttttataaataaagatattaataattctaat
aattatgataaaggtaattttctaagcgtaaatctcgaacgtatagctgatggctgggct
cctcctcattatgaaaagaaaattactataatataa

DBGET integrated database retrieval system