KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0044
Entry
FTW_0044          CDS       T00495                                 

Definition
(GenBank) hypothetical protein
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
SSDB
Other DBs
NCBI-ProteinID: ABO46048
Position
complement(42620..43336)
AA seq 238 aa
MQHINNINKNISLNNFVSLLKSQKYSLKRINFIPVMINKTSSPTILDIYDNKETLNVKIN
IFKIKPFTKLQSIYQEYIQNNNDLAIEILGYGLKVLLKLYILDTKALHKFTTKNSYYIQC
APKYTIDNIINNIYKLLSEDYCTVIDYKEKLINIKRKQIVVGDSYVGKSFLGAYIPSYVY
IINIKIYLISKNQYVINKIKTQIKKIEEKITNLPFKIELEISIENNKKNQIYLGYFNL
NT seq 717 nt   +upstreamnt  +downstreamnt
atgcaacacatcaataatatcaataaaaatatctctctaaataactttgtaagtcttcta
aaaagtcagaaatattctttgaaaagaataaatttcataccggtaatgattaataaaacc
tcatctcctaccatattagatatttatgataataaagaaactctaaatgtaaaaataaat
atctttaaaatcaaaccattcactaaattacagagtatttatcaagaatatatccaaaac
aataatgacttggctattgaaatacttggatacggattaaaagtgctactaaagttatac
attttagatactaaagcactgcacaaattcacaacaaaaaatagttattatattcaatgt
gctcccaaatacactatagataacataataaacaatatctataaattactctcggaagac
tattgcacagtaatagattataaagaaaaactaatcaatataaagagaaaacaaatagta
gtaggagattcttacgttggaaaatctttcttgggggcatatattccctcatatgtttat
attataaacattaagatatatctcattagtaaaaatcaatatgtcataaataaaatcaaa
actcaaattaaaaaaattgaggaaaaaattacaaatctcccatttaagatagaacttgaa
atatcaattgaaaataataaaaaaaatcagatatacctaggttattttaatttatga

DBGET integrated database retrieval system