KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0047
Entry
FTW_0047          CDS       T00495                                 

Definition
(GenBank) hypothetical protein
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
SSDB
Other DBs
NCBI-ProteinID: ABO46051
Position
complement(45168..46598)
AA seq 476 aa
MDEKRKDLSTNDASILKKTFDKLSNDIRDDFDKRIFDYSNTLLFKYYSNLYYFVPKSCLL
EINDKGHNGYYIPPQEYFFIEDKRTGKTLTYTTKSENIILPIRDITTIKQSDTSINISLE
FANNFDYDYVTIWIDPTLCKEDPSFATYIFNQVLEDNGSAKIKFSNHSYTTKNVQIEPIK
FQLKPTEKLVLNIHSPSLLYGFNIKIKDLFKYKNNDLNKIDFFLEVKTENYNDEKLSSLF
RVNLIPVFNSFDDYSSTSFASMNLSESKLKHHQKDDAQAIEVLSVYENNKQCDFNSFLFV
GQNEYYFNRSTQSLNYSSVLPQFSNKIIGTKIHTYTTWTQITEISDLIEINSNAIASISC
NISPIVINKALNNYNSNAKEMFNIIDMIISKNMYSKTTFLAIAKLLKINTNDLTLLSMLL
QDVEMDSTINELILTLSDKYNPKYKHFLNFHIGIICKFINQNTFSFIKKIVLNNSI
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggatgaaaaaagaaaagatttaagtacgaatgatgctagcatcctaaaaaaaactttt
gacaaactaagtaatgatataagagatgattttgataagagaatttttgattatagtaat
actcttttattcaagtattatagtaacctttattatttcgttcctaaatcatgcttatta
gaaataaatgataaaggacacaatggttactatattccgcctcaggaatattttttcata
gaagacaagagaacaggtaaaactctaacatatacgacaaagtcagaaaatataatactc
cctattagagatatcacaaccataaaacaaagtgatacatcaataaatatatcattggaa
tttgcaaataactttgactatgattatgttactatctggatagatccaactttatgtaaa
gaagatcctagctttgccacatacatatttaaccaagtattagaagataatggctcagca
aagattaaattttcaaatcatagttatacaacaaaaaatgtacaaatagaaccaattaag
ttccaattaaaaccaacagaaaaattagttctcaatatccattctcctagccttttatat
ggttttaacataaagatcaaagacttatttaaatacaaaaataatgacctcaacaaaatt
gacttttttttagaagttaaaactgaaaactataatgacgaaaaattatcatctctattt
agagttaatttaatacctgtgtttaatagttttgatgattactcaagcacctcatttgct
tcgatgaatctctcagagagtaaactaaaacatcatcaaaaagatgatgctcaagcaata
gaagtattatctgtttatgagaataataaacaatgtgattttaatagttttctttttgta
ggacagaatgagtattattttaatcgcagcacacaatctttaaattatagtagcgtactc
cctcaatttagtaataaaataataggaacaaaaatacatacatatacaacctggacacag
ataactgagatttctgatctaattgaaattaactcaaatgcaatagcatctataagctgt
aatatttctccaatagttattaacaaagcactaaacaactacaatagcaatgctaaagaa
atgtttaatataatagatatgatcatctctaagaatatgtattcaaaaacaacattccta
gctatagcaaagcttttaaagattaatactaatgacttaactttactatcaatgctccta
caagatgttgagatggactctactataaatgagctaattttaaccttaagtgataaatat
aacccaaaatataaacatttcttaaattttcatattggtattatatgcaaatttataaat
caaaacacctttagctttattaaaaagattgttttaaataactctatataa

DBGET integrated database retrieval system