KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0156Help
Entry
FTW_0156          CDS       T00495                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
ftw00010  Glycolysis / Gluconeogenesis
ftw00051  Fructose and mannose metabolism
ftw00562  Inositol phosphate metabolism
ftw01100  Metabolic pathways
ftw01110  Biosynthesis of secondary metabolites
ftw01120  Microbial metabolism in diverse environments
ftw01130  Biosynthesis of antibiotics
ftw01200  Carbon metabolism
ftw01230  Biosynthesis of amino acids
Module
ftw_M00002  Glycolysis, core module involving three-carbon compounds
ftw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ftw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTW_0156 (tpiA)
   00051 Fructose and mannose metabolism
    FTW_0156 (tpiA)
   00562 Inositol phosphate metabolism
    FTW_0156 (tpiA)
Enzymes [BR:ftw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FTW_0156 (tpiA)
Exosome [BR:ftw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FTW_0156 (tpiA)
  Exosomal proteins of bladder cancer cells
   FTW_0156 (tpiA)
  Exosomal proteins of melanoma cells
   FTW_0156 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM PEP_hydrolase
Motif
Other DBs
NCBI-ProteinID: ABO46142
Structure
PDB: 

Position
168323..169069
Genome map
AA seq 248 aa AA seqDB search
MGNWKMNGNSTSIKELCSGISQVQYDTSRVAIAVFPSSVYVKEVISQLPEKVGVGLQNIT
FYDDGAYTGEISARMLEDIGCDYLLIGHSERRSLFAESDEDVFKKLNKIIDTTITPVVCI
GESLDDRQSGKLKQVLATQLSLILENLSVEQLAKVVIAYEPVWAIGTGVVASLEQIQETH
QFIRSLLAKVDERLAKNIKIVYGGSLKAENAKDILSLPDVDGGLIGGASLKAAEFNEIIN
QANKICTE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactggaaaatgaatggtaactctacaagcataaaagagctctgtagtggtata
tcacaagtgcaatatgatacttcaagagtagctattgctgtttttccatcaagtgtttat
gttaaagaagtaatctcacagctgccagagaaagtaggtgttggtctacaaaatattact
ttttatgatgatggtgcttatactggtgagatatctgctaggatgttggaagatattggt
tgtgactacttactaattggtcattctgagagaagatctctatttgctgagtctgatgaa
gatgtttttaaaaagcttaacaagattatagatactactataacgccagtagtgtgtatt
ggtgaatcactagatgatagacaaagtggtaagctcaaacaagttttagcaacacaacta
agcttaatcttagaaaatttatctgttgagcagttagcaaaagtcgtaattgcatatgaa
cctgtctgggcaataggcacaggagttgtggcttcactagagcagattcaagaaacacat
caatttattcgttcattgttagctaaagttgatgaaagacttgctaaaaatataaaaata
gtgtatggtggtagcctaaaagctgaaaatgctaaagatatattaagcttaccagatgtt
gacggtggtttaattggtggcgcatctttgaaggctgctgaatttaacgaaataataaat
caagcaaataagatatgtacggaataa

DBGET integrated database retrieval system