KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0472Help
Entry
FTW_0472          CDS       T00495                                 

Gene name
proS
Definition
(GenBank) prolyl-tRNA synthetase
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
ftw00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ftw00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FTW_0472 (proS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ftw01007]
    FTW_0472 (proS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ftw03016]
    FTW_0472 (proS)
Enzymes [BR:ftw01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     FTW_0472 (proS)
Amino acid related enzymes [BR:ftw01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   FTW_0472 (proS)
Transfer RNA biogenesis [BR:ftw03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    FTW_0472 (proS)
 Prokaryotic type
    FTW_0472 (proS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b tRNA_edit HGTP_anticodon
Motif
Other DBs
NCBI-ProteinID: ABO46391
UniProt: A4IWT9
Position
complement(460458..462155)
Genome map
AA seq 565 aa AA seqDB search
MKATQTLIATTKELPKEAVLISHQYMLKAGLIKKLASGIYTWMPLGLKVLQKIQNIVRDE
MNKAGASELLLPSILPSELLQETHRWDKFGPELLKLHDRHNRDFCYGPTHEEPIVDMARD
TIKSYKQLPLNLYQIQTKFRDEIRPRFGVMRAREFIMKDAYSFHENSQCLRNTYNTMYAT
YCNILDKIGLAYRPVKADTGAIGGDNSHEFQVLANAGEDIICYSNGSDYAANIELATYAK
PDLSKRVNSQNTIEKIHTPNIKTIEKLCKEMSFDIKKTIKTMVIKDAGGNFFALVIRGDH
ELNETKINKLDQIIAPYTLATKEEIFSIFNANPGSLGIYNCPISIIADYSAIAITDLVCG
ANEDDYHFTNVNWDRDVTNYQIADIRNVVTGDISPDGKGTLELTNGIEVGHIFELEDVYS
KPMNANIIGQDGKSKPMLMGCYGFGVSRVMAAAIEQSHDENGIIWPESIAPYQVAILPIN
YNKSDKIKEVADKLYQDLLGDGIDVLLDDRGARPGVMFADADLIGYSHHVVIGDRLLEQG
LIEYKNRKTQEKQEITIAELIKILK
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaacacaaactctaattgctacgacaaaggaactaccaaaagaagcagttcta
attagtcatcaatatatgctcaaagctggtcttatcaagaagctagcttctggtatctat
acatggatgcctctaggtctaaaggtactccaaaaaatccaaaatatagtacgtgatgag
atgaataaagctggagcaagcgaactacttttaccaagtatactaccttcagagctttta
caagaaactcatcgctgggataaatttggtccagaacttttaaaattacatgatcgacat
aatagagatttctgttatggtccaacacatgaagaaccaattgttgatatggctagagat
actatcaaaagctacaaacaattgcctttaaatctttatcaaatccaaactaaattcaga
gatgagattcgccctcgttttggtgtaatgcgtgcacgtgaatttataatgaaagatgct
tattcatttcatgaaaatagtcaatgtctacgcaatacttataatacaatgtacgcaacc
tactgcaatatccttgacaaaataggcttagcttatcgccctgttaaagctgataccgga
gctataggtggtgataatagtcatgagtttcaggtattagcaaatgctggtgaagatatt
atttgctatagtaatggttctgactatgctgcaaatattgagttagcaacttatgcaaaa
cctgatctaagcaaaagagtaaactctcaaaataccattgagaaaatacacactccaaac
atcaaaactatcgaaaaactctgtaaagagatgagctttgatattaaaaagactatcaaa
actatggttatcaaagatgccggaggaaatttctttgctttagttatccgaggtgatcat
gaattaaacgaaactaagattaataagcttgatcaaattattgcaccatatacattagct
actaaagaagagattttttcaatatttaatgctaatccaggctcgcttggtatatataac
tgccctatcagtataatcgctgactacagtgcaattgctattacagatctagtttgtggc
gctaatgaagatgattatcactttacaaatgtaaactgggatagagatgtaactaactat
caaatcgccgacattagaaatgtagtaactggcgatatttcccctgatggtaaaggcact
ctagaacttacaaatggtatcgaggttggtcatatttttgaacttgaagatgtctactca
aaaccaatgaatgcaaatataatcggtcaagatggtaaatctaaacctatgcttatgggt
tgttatggttttggagtgtcgcgtgtgatggcagcagcaattgagcaatctcatgatgaa
aatgggattatatggcctgagtctattgctccataccaagttgctatactacctatcaac
tacaataaatctgacaagattaaagaagtagcagataaactttatcaagacttgcttgga
gatggtattgatgtcctattagatgatcgaggtgctagacctggcgtgatgttcgctgat
gctgatctaattggttactctcatcatgtagtaattggcgatagactacttgagcaaggg
ctgattgaatataagaatcgcaaaactcaagaaaaacaagagataactattgcagagctg
atcaagattttaaaataa

DBGET integrated database retrieval system