KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0787Help
Entry
FTW_0787          CDS       T00495                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K15984  16S rRNA (guanine1516-N2)-methyltransferase [EC:2.1.1.242]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Brite
KEGG Orthology (KO) [BR:ftw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ftw03009]
    FTW_0787
Enzymes [BR:ftw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.242  16S rRNA (guanine1516-N2)-methyltransferase
     FTW_0787
Ribosome biogenesis [BR:ftw03009]
 Prokaryotic type
  rRNA modification factors
   16S rRNA modification factors
    FTW_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SAM_MT RrnaAD Cons_hypoth95 Methyltransf_25 Methyltransf_24
Motif
Other DBs
NCBI-ProteinID: ABO46659
UniProt: A4IXK7
Position
complement(763618..764343)
Genome map
AA seq 241 aa AA seqDB search
MQINISNLDVKNHLDKFIEDRLEYEFCKQDKYLYLENDNLKLHYNNKELFIDFNDSEILN
RINPKTKKCSVVQAIEGRSKAKLTILDTTAGLGRDTFTLAARGHTLLTLEKDSYLYLLLK
DALQRAQQINYLKEIANRITLINIDSNEYILTTDKSFDCVYVDPMFPPRKKSAKVKQGMQ
ILHQVGFNDEVSNSNLLDNIIQTQISPKAVVKRPINAEFLSNKKPSSQLKGKTNRFDIYS
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcagataaatatttctaacttagatgtaaagaatcaccttgataaatttatagaagat
agattagagtatgagttttgcaagcaagataaatacttataccttgaaaatgataatcta
aaacttcattataataataaagaattatttatagattttaatgatagtgaaatcttaaat
agaataaatcctaaaactaagaaatgtagtgttgtacaggcaattgaaggtcgctctaaa
gctaagcttaccatccttgatactacagcaggattaggtagggatactttcacattagct
gctagaggccatactttactaactctagaaaaagattcttatctatatctactactgaaa
gatgctttacaaagagctcaacaaataaattatttgaaagagattgccaatagaataacc
ttaatcaatatagatagtaatgagtatatacttacgactgataaatcattcgattgtgtc
tatgttgacccaatgtttccaccacgtaaaaaaagtgctaaagtcaaacaaggtatgcaa
atccttcatcaagtaggatttaatgatgaagtatctaactcgaatttattagacaacatt
atccaaacacaaatatcccccaaagctgtagttaaaagacccataaatgccgaatttctc
agtaacaaaaagccaagctcacagcttaaaggtaagactaatagatttgatatttatagt
ctataa

DBGET integrated database retrieval system