KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_0809Help
Entry
FTW_0809          CDS       T00495                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase component, pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
ftw00010  Glycolysis / Gluconeogenesis
ftw00020  Citrate cycle (TCA cycle)
ftw00620  Pyruvate metabolism
ftw01100  Metabolic pathways
ftw01110  Biosynthesis of secondary metabolites
ftw01120  Microbial metabolism in diverse environments
ftw01130  Biosynthesis of antibiotics
ftw01200  Carbon metabolism
Module
ftw_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ftw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTW_0809 (aceF)
   00020 Citrate cycle (TCA cycle)
    FTW_0809 (aceF)
   00620 Pyruvate metabolism
    FTW_0809 (aceF)
Enzymes [BR:ftw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FTW_0809 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 RnfC_N NQRA HlyD_3 PTS_EIIA_1 DUF2118 HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABO46681
Position
786947..788842
Genome map
AA seq 631 aa AA seqDB search
MSIEIVKVPDIGDYDNVDVIEVNVAVGDVIAEEDSLITLETDKASMEVPSPFAGKITKLT
VKVGDKVSQGTAIMEVEVESAADQAATTQSQPQTTSSAPVAATTNQIVDVEVPDIGDYDS
VDVIEVSVKVGDEIAEEDSLITLETDKASMEVPSPVAGKVVEVITKVGDKVSQGSLILKV
ETGSSAQAPAQEQSQQSAPVKSAAEEIIDVKVPDIGDYDSVDVIEVSVAVGDKIEEEDSL
ITLETDKASMEVPSPVAGEVVEIITKVGDKVSQGSLILKVKTQGSAPVELTSSQPASAKQ
EQAKQQAATPAAPTPASSSVNEYAVDNSNAHASPAVRKLARILNIDLSKVKATGRKGRVT
KEDCYNYIKHAVTQVQTGKVAASGSGLDLLDDPVVDFAKFGEIETQPLSRINKISAKNLH
RNWVKIPHVTFYDDADVTDLEEFRNAKKAFAEKKGIKITPLSFLVKAAAVALQEFPRFNS
SLSNDGENLIIKKYYNIGFAADTPAGLMVPVVKDADKKGIIEISKDIMELAGKARDGKLG
AKDMTGATFTISSLGVLGTTSFTPIINMPEVAIMGVSKTAVKPIWNGKEFIPRTMLPLSL
STDHRVIDGALAAKFLTRYCQILSDLREIIM
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagagatagttaaagtccctgatattggggattatgataacgttgatgtgatc
gaggttaatgttgctgtaggtgatgttattgctgaagaagattcactaattacgttagaa
acagataaagcaagtatggaggttccatctccatttgcaggtaagatcactaaattaact
gtaaaagttggtgataaagtttctcagggaactgcaataatggaagttgaggttgagagt
gctgctgatcaagctgctactacacaatcacaacctcaaacaactagttcagctcctgta
gctgctacgacgaaccagattgttgatgtcgaggttccagatattggcgactatgatagt
gttgatgtgattgaggtgtctgtaaaagtaggtgatgagatagcagaagaggattcgcta
attacgcttgaaacagataaggctagtatggaagtaccatcgcctgtagcgggtaaggtt
gttgaagttattactaaggttggtgacaaggtttcgcaaggtagcttgattttaaaggtt
gaaacaggctctagtgcacaagctccagctcaagaacagtcacaacaatctgcaccagtt
aaatccgctgctgaagaaattattgatgtaaaagttcctgatatcggtgattacgatagt
gttgatgtgattgaagtatctgtagctgttggtgataagattgaagaagaagattctttg
attacattagaaactgataaggcaagcatggaggttccgtctccagttgctggtgaagtt
gttgaaataatcacaaaagttggtgataaagtttcacaaggtagtttaattcttaaggtc
aaaacacaaggttcagcaccggtagagctaactagttcacaaccagcgtcagctaaacaa
gagcaagctaaacagcaagctgctacacctgctgctccaacgccagcgtcaagttcggta
aatgagtatgctgtagataattctaatgcacatgcgtctcctgcagtgagaaagctagca
cgaattctaaatattgatctaagtaaggttaaagctacagggcgtaaaggtcgtgtaaca
aaagaagattgttataactatattaagcatgctgtcacacaagttcaaactggtaaggtc
gctgctagtggtagtggtttagatcttttagatgatcctgttgttgattttgctaagttt
ggtgagattgaaactcaaccattatcaagaattaacaagattagtgctaagaatttacat
cgtaactgggtgaagattcctcatgttacattctatgatgatgcggatgtcacagactta
gaagagttcagaaatgctaagaaagcctttgctgagaaaaaaggtattaagattacacct
ttatcattcttggttaaagctgctgcagttgcattacaagagttcccaagatttaatagc
tcattatcaaatgatggtgagaacttaattatcaagaagtattataatattggttttgct
gcagatactccagctggtttaatggttccagttgtcaaagatgctgataaaaagggtatc
attgaaatatcaaaagatattatggagttggctggcaaagctcgtgatggtaaacttggc
gcaaaggatatgacaggtgctacatttactatctcaagcttaggcgtgttaggtactacg
tcatttacgcctattataaatatgccagaggtggctattatgggtgtatctaagacagca
gtgaagcctatttggaatggtaaagagtttattcctagaactatgctaccattatcatta
tctacagatcatagagtgatagatggcgcattagcagctaaattcttaactagatattgt
cagattttatctgatttacgtgaaatcataatgtaa

DBGET integrated database retrieval system