KEGG   Francisella tularensis subsp. tularensis WY96-3418: FTW_1646Help
Entry
FTW_1646          CDS       T00495                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ftw  Francisella tularensis subsp. tularensis WY96-3418
Pathway
ftw00260  Glycine, serine and threonine metabolism
ftw00750  Vitamin B6 metabolism
ftw01100  Metabolic pathways
ftw01110  Biosynthesis of secondary metabolites
ftw01120  Microbial metabolism in diverse environments
ftw01230  Biosynthesis of amino acids
Module
ftw_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ftw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FTW_1646 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FTW_1646 (thrC)
Enzymes [BR:ftw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FTW_1646 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N IL6
Motif
Other DBs
NCBI-ProteinID: ABO47338
Position
complement(1548164..1549399)
Genome map
AA seq 411 aa AA seqDB search
MNFISTRDKNIKVSLSEAMQSGLAPDGGLFVLERFPTVNWQSFAKDISYAKFAANTLREF
FKGDQLEDSLDKICNNAFTFEAPVRRLDKTTSVLELFHGPTLSFKDFGARFLANCLSSID
SEKPFTILVATSGDTGSAVAAAFHGKSNIRVIVMFPKGKISKRQEKQITCWGDNIQAVEV
EGVFDDCQSLVKEAFKTPWWTERTKLNTSNSINIGRLLPQSTYYAYTSWQHYLQTGEKAN
YIVPSGNIGNITAAFWAKQMGFPIGEISMSLNANDTVVDYLETGKFNPKASVETLANAMD
VGNPSNFERLLYLLGNYENFKANVKAICVSDFEIIEEIKQVYRQYHEVVCPHTTTGFVAK
NQLDSNKDYIIVATAHPAKFESVIEPILDIQVPPTPALQKLLKLSLKADVI
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaattttattagtactagagataaaaatattaaagtttcactaagtgaagcgatgcag
tctggattagctcctgatggaggattatttgtcctagagagatttcctacagttaattgg
cagagttttgctaaagatatcagttacgcgaagtttgctgctaatactctaagagaattc
tttaaaggagatcagctagaagactctttagataaaatttgtaataatgcttttactttt
gaggctcctgtaagaagattagataaaaccacatcagttttagagctttttcatggtcca
actttatcttttaaagatttcggtgcgagatttttagcaaactgtttaagctctatcgat
agtgagaagccatttactattttagtggcaacttctggagatacaggttcagcagtagct
gcagcttttcatggtaagagcaatatccgtgttatagtgatgtttcctaaaggtaaaatc
tctaaaagacaagaaaagcagataacttgttggggagataatatccaagcagttgaagtt
gaaggagtttttgatgactgtcaaagtctagtcaaagaagcttttaagacaccttggtgg
acagagaggactaagttaaatacatcaaatagtattaatatcggtagattactaccacaa
tcaacttattatgcttatacatcgtggcaacattatttgcagaccggagagaaagcaaac
tatatagttccatctggcaatattggtaatataactgctgctttttgggcaaagcaaatg
ggctttccaataggtgaaatatcgatgagtttaaatgctaatgatactgttgttgactat
ctagagactggtaagtttaatcctaaggcaagtgttgaaacgctagcaaatgctatggat
gttggtaaccctagtaattttgaaagattgttatacttgttgggtaattatgaaaatttc
aaagctaatgttaaggctatatgtgtttctgactttgaaattatagaagaaataaaacaa
gtgtatcgtcaatatcatgaagttgtttgtccacacacaacaacaggttttgtagcaaaa
aatcagttagatagcaataaagattatataatcgtagcaactgcacatcctgctaagttt
gaaagtgtaattgagcctatattagatatacaagtgccgcctacaccggcgttacaaaag
cttttgaagcttagcttaaaagcggatgtgatctga

DBGET integrated database retrieval system